Property Summary

Ligand Count 138
NCBI Gene PubMed Count 40
PubMed Score 62.50
PubTator Score 85.73

Knowledge Summary

Patent (10,770)

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 8.1e-07
Multiple Sclerosis 540 2.5e-03
Disease Target Count Z-score Confidence
Amyotrophic lateral sclerosis type 3 17 3.458 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
Multiple Sclerosis 1.400 2.5e-03
osteosarcoma 1.700 8.1e-07

Gene RIF (31)

AA Sequence

MALTPESPSSFPGLAATGSSVPEPPGGPNATLNSSWASPTEPSSLEDLVATGTIGTLLSAMGVVGVVGNA      1 - 70
YTLVVTCRSLRAVASMYVYVVNLALADLLYLLSIPFIVATYVTKEWHFGDVGCRVLFGLDFLTMHASIFT     71 - 140
LTVMSSERYAAVLRPLDTVQRPKGYRKLLALGTWLLALLLTLPVMLAMRLVRRGPKSLCLPAWGPRAHRA    141 - 210
YLTLLFATSIAGPGLLIGLLYARLARAYRRSQRASFKRARRPGARALRLVLGIVLLFWACFLPFWLWQLL    211 - 280
AQYHQAPLAPRTARIVNYLTTCLTYGNSCANPFLYTLLTRNYRDHLRGRVRGPGSGGGRGPVPSLQPRAR    281 - 350
FQRCSGRSLSSCSPQPTDSLVLAPAAPARPAPEGPRAPA                                   351 - 389
//

Text Mined References (42)

PMID Year Title