Property Summary

NCBI Gene PubMed Count 37
PubMed Score 59.21
PubTator Score 85.73

Knowledge Summary

Patent (10,770)

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 8.1e-07
Multiple Sclerosis 498 2.5e-03
Disease Target Count Z-score Confidence
Amyotrophic lateral sclerosis type 3 15 3.491 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.700 8.1e-07
Multiple Sclerosis 1.400 2.5e-03

Gene RIF (28)

PMID Text
26381851 UTII-R expression on biopsy was associated with Gleason upgrading and pathology upstaging in prostate cancer patients.
25514221 Urotensin II can induce the proliferation of BEL-7402 cells via the urotensin receptor mediated PKC/ERK/p38 MAPK signaling pathways.
24893613 High UTR expression is an independent prognostic factor of good prognosis for non muscle invasive bladder transitional cancer.
24391740 family-based analysis of association between blood pressure, glomerular filtration and genes of the urotensin-II pathway (urotensin-II, urotensin-II related peptide, urotensin-II receptor) saturated with 28 tagging single nucleotide polymorphisms
24372535 UTR protein and mRNA levels were increased in colon cancer cell lines and in colon adenoma and adenocarcinoma. UTR appears to be involved in the regulation of colon cancer cell invasion and motility.
24357333 Report interaction of urantide with urotensin II receptor.
23344731 Data suggest that UTS2R in aortic endothelium is involved in development of diabetes-associated atherosclerosis; diabetes-associated plaque development is attenuated by urotensin II/UTS2R antagonism in in vitro setting.
22563490 Data show that vasoactive peptide urotensin II receptor and GABA(A)R are co-expressed in cerebellar glial cells from rat brain slices, in human native astrocytes and in glioma cell line.
22245063 presence of functional nuclear UT in various rat and monkey tissues as well as in human cell lines
21080343 Urotensin II receptor predicts the clinical outcome of prostate cancer patients and is involved in the regulation of motility of prostate adenocarcinoma cells.
20870804 hUII may deteriorate monocrotaline-induced cardiac hypertrophy mainly through a vasoconstriction of the pulmonary artery and partly through the suppression of ANP secretion.
20479331 An increased sensitivity to U-II in preeclampsia might be achieved by upregulation of placental U-II receptors.
20428787 These findings suggest that the intrahepatic UII/UT system has an important pathophysiological role in cirrhosis and portal hypertension.
19788716 This study demonstrates that UT receptor is expressed on the endothelium of HCC. U-II/UT receptor system is involved in HCC function and it involves endothelium and NO pathway.
19111831 Demonstrate an important role for UTS2R in the pathogenesis of atherosclerosis. The use of UTS2R receptor antagonists may provide a beneficial tool in the management of this debilitating disease process.
19001524 Urotensin II receptor activation in vivo enhanced the adrenocortical expression of immunoreactive aldosterone synthase.
18423797 Results describe the solution structure of urotensin-II receptor extracellular loop III and characterize its interaction with urotensin-II.
18409194 To understand the molecular interactions of hU-II and certain antagonists with the hUT-II receptor, a model of the hUT-II receptor in an active conformation with all its connecting loops was constructed by homology modeling.
17905478 REsults describe the differential expression of urotensin II receptors in cardiovascular tissues from rats and humans and suggest that it may account for the diverse vascular actions reported for urotensin-II.
17686550 Data show that both urotensin II and urotensin II receptor are expressed in adrenal tumors and attached non-neoplastic adrenal tissues, and suggest possible roles of UII and UT-R in tumor growth and/or secretion.
17617581 Cloning and functional characterization of the human UT receptor gene promoter revealed the presence of NF-kappaB-binding sites involved in UT receptor gene expression
17595527 GPR14 is a candidate for the guanylate cyclase independent receptor for guanylin peptides.
17537987 Diagnostic reagent kits using human rhabdomyosarcoma cells expressing UTS2R were compared.
16597476 Observational study of gene-disease association. (HuGE Navigator)
15752584 Since both mRNA for UT receptor and U-II binding were still present. ANG II receptors were also present as shown by ANG II-induced calcium mobilization.
15476949 Subjects with S89N amino acid substitution are more insulin-resistant and thus more susceptible to type 2 diabetes mellitus development.
15306183 monocytes and macrophages were the largest producers of GPR14 mRNA, with relatively little expression in foam cells, lymphocytes, and platelets.
14753294 urotensin II receptor (U2R) is up-regulated by interferon-gamma

AA Sequence

MALTPESPSSFPGLAATGSSVPEPPGGPNATLNSSWASPTEPSSLEDLVATGTIGTLLSAMGVVGVVGNA      1 - 70
YTLVVTCRSLRAVASMYVYVVNLALADLLYLLSIPFIVATYVTKEWHFGDVGCRVLFGLDFLTMHASIFT     71 - 140
LTVMSSERYAAVLRPLDTVQRPKGYRKLLALGTWLLALLLTLPVMLAMRLVRRGPKSLCLPAWGPRAHRA    141 - 210
YLTLLFATSIAGPGLLIGLLYARLARAYRRSQRASFKRARRPGARALRLVLGIVLLFWACFLPFWLWQLL    211 - 280
AQYHQAPLAPRTARIVNYLTTCLTYGNSCANPFLYTLLTRNYRDHLRGRVRGPGSGGGRGPVPSLQPRAR    281 - 350
FQRCSGRSLSSCSPQPTDSLVLAPAAPARPAPEGPRAPA                                   351 - 389
//

Text Mined References (39)

PMID Year Title
26381851 2015 Urotensin II receptor on preoperative biopsy is associated with upstaging and upgrading in prostate cancer.
25514221 2014 Up-regulation of urotensin II and its receptor contributes to human hepatocellular carcinoma growth via activation of the PKC, ERK1/2, and p38 MAPK signaling pathways.
24893613 2014 Urotensin II receptor determines prognosis of bladder cancer regulating cell motility/invasion.
24391740 2013 Urotensin-II system in genetic control of blood pressure and renal function.
24372535 2014 Urotensin-II receptor is over-expressed in colon cancer cell lines and in colon carcinoma in humans.
24357333 2014 Urantide conformation and interaction with the urotensin-II receptor.
23344731 2013 Urotensin II receptor antagonism confers vasoprotective effects in diabetes associated atherosclerosis: studies in humans and in a mouse model of diabetes.
22563490 2012 Down-regulation of GABA(A) receptor via promiscuity with the vasoactive peptide urotensin II receptor. Potential involvement in astrocyte plasticity.
22245063 2012 Presence of urotensin-II receptors at the cell nucleus: specific tissue distribution and hypoxia-induced modulation.
21080343 2011 Urotensin II receptor predicts the clinical outcome of prostate cancer patients and is involved in the regulation of motility of prostate adenocarcinoma cells.
20870804 2010 Urotensin II receptor antagonist attenuates monocrotaline-induced cardiac hypertrophy in rats.
20479331 2010 Upregulation of urotensin II receptor in preeclampsia causes in vitro placental release of soluble vascular endothelial growth factor receptor 1 in hypoxia.
20428787 2010 Increased expression of urotensin II and GPR14 in patients with cirrhosis and portal hypertension.
19788716 2010 Urotensin II: a novel target in human corpus cavernosum.
19111831 2009 Targeted overexpression of the human urotensin receptor transgene in smooth muscle cells: effect of UT antagonism in ApoE knockout mice fed with Western diet.
19001524 2009 Expression and functional role of urotensin-II and its receptor in the adrenal cortex and medulla: novel insights for the pathophysiology of primary aldosteronism.
18423797 2008 Solution structure of urotensin-II receptor extracellular loop III and characterization of its interaction with urotensin-II.
18409194 2008 Three-dimensional model of the human urotensin-II receptor: docking of human urotensin-II and nonpeptide antagonists in the binding site and comparison with an antagonist pharmacophore model.
17905478 2008 Immunocytochemical localization of the urotensin-II receptor, UT, to rat and human tissues: relevance to function.
17686550 2008 Immunolocalization of urotensin II and its receptor in human adrenal tumors and attached non-neoplastic adrenal tissues.
17617581 2007 Urotensin II is a new chemotactic factor for UT receptor-expressing monocytes.
17595527 2007 Ligands and signaling of the G-protein-coupled receptor GPR14, expressed in human kidney cells.
17537987 2007 Evaluation of no-wash calcium assay kits: enabling tools for calcium mobilization.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16754659 2006 Stable association between G alpha(q) and phospholipase C beta 1 in living cells.
16597476 2006 Haplotypes in the urotensin II gene and urotensin II receptor gene are associated with insulin resistance and impaired glucose tolerance.
15752584 2005 Characterization of functional urotensin II receptors in human skeletal muscle myoblasts: comparison with angiotensin II receptors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15476949 2004 Genetic variations at urotensin II and urotensin II receptor genes and risk of type 2 diabetes mellitus in Japanese.
15306183 2004 Increased expression of urotensin II and its cognate receptor GPR14 in atherosclerotic lesions of the human aorta.
14753294 2003 The expression of urotensin II receptor (U2R) is up-regulated by interferon-gamma.
14550283 2003 Identification of urotensin II-related peptide as the urotensin II-immunoreactive molecule in the rat brain.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11015293 2000 Orphan-receptor ligand human urotensin II: receptor localization in human tissues and comparison of vasoconstrictor responses with endothelin-1.
10828617 2000 Assignment of the GPR14 gene coding for the G-protein-coupled receptor 14 to human chromosome 17q25.3 by fluorescent in situ hybridization.
10581185 1999 Identification of urotensin II as the endogenous ligand for the orphan G-protein-coupled receptor GPR14.
10499587 1999 Human urotensin-II is a potent vasoconstrictor and agonist for the orphan receptor GPR14.
9861051 1998 Cloning of the cDNA encoding the urotensin II precursor in frog and human reveals intense expression of the urotensin II gene in motoneurons of the spinal cord.
8666380 1995 Cloning and chromosomal mapping of three novel genes, GPR9, GPR10, and GPR14, encoding receptors related to interleukin 8, neuropeptide Y, and somatostatin receptors.