Property Summary

NCBI Gene PubMed Count 99
PubMed Score 412.73
PubTator Score 375.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
glioblastoma 1.200 9.8e-03
hepatocellular carcinoma -2.300 2.1e-02
osteosarcoma -2.570 3.3e-05
psoriasis 1.300 5.1e-06
tuberculosis 2.500 3.5e-02

Gene RIF (88)

AA Sequence

MYKLASCCLLFIGFLNPLLSLPLLDSREISFQLSAPHEDARLTPEELERASLLQILPEMLGAERGDILRK      1 - 70
ADSSTNIFNPRGNLRKFQDFSGQDPNILLSHLLARIWKPYKKRETPDCFWKYCV                     71 - 124
//

Text Mined References (99)

PMID Year Title