Property Summary

NCBI Gene PubMed Count 76
PubMed Score 401.11
PubTator Score 176.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
osteosarcoma -1.880 2.7e-04
atypical teratoid / rhabdoid tumor 1.100 2.5e-04
medulloblastoma, large-cell -2.400 6.4e-05
juvenile dermatomyositis 1.178 7.8e-11
acute quadriplegic myopathy 1.103 3.5e-05
tuberculosis and treatment for 3 months 1.500 5.3e-08
non-small cell lung cancer -1.449 1.7e-21
intraductal papillary-mucinous neoplasm ... -1.300 7.6e-03
lung cancer -1.700 2.6e-04
group 4 medulloblastoma -1.500 2.7e-02
subependymal giant cell astrocytoma 1.914 1.6e-02
lung adenocarcinoma -1.700 8.8e-19
lung carcinoma -2.100 6.2e-27
breast carcinoma -1.200 1.1e-29
progressive supranuclear palsy -1.100 2.3e-02
Breast cancer -1.600 2.0e-12
ductal carcinoma in situ -1.200 4.9e-05
invasive ductal carcinoma -1.500 9.4e-04
ovarian cancer -1.500 2.4e-05
Gaucher disease type 1 -1.700 1.4e-02
pituitary cancer -1.700 6.9e-05

Gene RIF (33)

PMID Text
26974331 Correlation of Utrophin Levels with the Dystrophin Protein Complex and Muscle Fibre Regeneration in Duchenne and Becker Muscular Dystrophy Muscle Biopsies.
26516677 probed the role of N-terminal CH1 and C-terminal CH2 domains in the structure and function of dystrophin tandem CH domain and compared with earlier results on utrophin to understand the unifying principles of how tandem CH domains work
26015394 there is an inverse correlation between the level of muscle fibrosis and the level of utrophin and that of the number of revertant myofibers in Duchenne muscular dystrophy
25434519 targeting Drp1-dependent mitochondrial dynamics may provide a novel strategy to suppress breast cancer metastasis and improve the chemotherapeutic effect in the future
24628267 The actin binding affinity of the utrophin tandem calponin-homology domain (CH) is determined by its CH1 domain, when compared to its CH2 domain.
23937156 this study demonstrated a pathway for Drp1 autophagic degradation. Chemical inhibition of lysosomal degradation and ATG7 knockdown increased Drp1 levels.
23363418 UtroUp recognises 18 base pairs of the utrophin promoter and efficiently drives utrophin upregulation.
23345212 The present findings demonstrate that genotoxic stress in neurons results in p53-dependent declines in Drp1 and parkin levels contribute to altered mitochondrial morphology and cell death.
23163995 This family study showed that the 6q24.2 mircoduplication of the utrophin gene is a potential risk factor for the development of annular pancreas.
22609462 UAPC located in caveolae and non-caveolae lipid raft domains of HUVECs may have a mechanosensory function that could participate in the control of eNOS activity
22275054 Examined the thermodynamic stability and aggregation of utrophin N-ABD and compared with that of dystrophin. Utrophin N-ABD has decreased denaturant and thermal stability, unfolds faster, and is correspondingly more susceptible to proteolysis.
21672318 Homeobox protein engrailed-1 protein regulates transcription of the utrophin gene.
21482524 EN1 might be a negative regulatory factor for UTROPHIN.
21326213 These results indicate that Drp1-dependent mitochondrial positioning and activity controls T-cell activation by fuelling central supramolecular activation cluster assembly at the immune synapse.
20625423 The structural and functional properties of dystrophins and utrophins in brain, the consequences of dystrophins loss-of-function, are discussed.
20434517 Distribution of dystrophin- and utrophin-associated protein complexes during activation of human neutrophils.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20347265 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19945424 the 8th and 9th spectrin-like repeats (R8 and R9) of utrophin cooperatively form a PAR-1b-interacting domain, and that Ser1258 within R9 is specifically phosphorylated by PAR-1b.
18945675 specifically designed ZFPs can act as strong transcriptional activators of the utrophin A promoter
17507653 These studies suggest "repressing repressors" as a potential strategy for achieving utrophin up-regulation in Duchenne's muscular dystrophy, and they provide a model for utrophin-A regulation in muscle.
16710609 Review. The role of utrophin in the assembly of the dystrophin glycoprotein complex in brain, blood-brain barrier & choroid plexus, retina, and kidney is discussed.
16598790 beside its known effect on general muscle protein degradation, calpain contributes to Duchenne muscular dystrophy pathology by specifically degrading the compensatory protein utrophin
16595608 Utrophin expression increases with age in DMD and there is a significant positive correlation between the quantity of utrophin at initial biopsy and time to becoming wheelchair-bound.
16295426 30 muscle biopsies of patients with Duchenne muscular dystrophy (DMD) showed all or majority of muscle fibers deficient for dystrophin and positive for utrophin.
16198105 Utrophin localisation is in human muscle.The A-utrophin on the sarcolemma of foetal human muscle fibres, regenerating fibres, fibres deficient in dystrophin and on blood vessels and neuromuscular junctions. B-utrophin is only detected on blood vessels.
16049973 increased expression of truncated cSHMT, Tbx3 and utrophin in plasma samples obtained from patients at early stages of ovarian cancer and breast cancer
12633873 regulation of promoter by Ets, Ap-1 and GATA factor families
12619170 Utrophin up-regulation is regeneration-associated and is proportional to the quantity of regenerating myofibers, but is not specific for Duchenne muscular dystrophy.
12499352 Drp1 and Mfn2, but not other proteins implicated in the regulation of mitochondrial morphology, colocalize with Bax in apoptotic foci
11997063 Sp1 and the ets-related transcription factor complex GABP alpha/beta functionally cooperate to activate the utrophin promoter.
11875058 transcriptional upregulation in regenerating muscle
11861579 Accumulation of repeated elements could account for intron expansion in the evolution of the gene.

AA Sequence

MAKYGEHEASPDNGQNEFSDIIKSRSDEHNDVQKKTFTKWINARFSKSGKPPINDMFTDLKDGRKLLDLL      1 - 70
EGLTGTSLPKERGSTRVHALNNVNRVLQVLHQNNVELVNIGGTDIVDGNHKLTLGLLWSIILHWQVKDVM     71 - 140
KDVMSDLQQTNSEKILLSWVRQTTRPYSQVNVLNFTTSWTDGLAFNAVLHRHKPDLFSWDKVVKMSPIER    141 - 210
LEHAFSKAQTYLGIEKLLDPEDVAVQLPDKKSIIMYLTSLFEVLPQQVTIDAIREVETLPRKYKKECEEE    211 - 280
AINIQSTAPEEEHESPRAETPSTVTEVDMDLDSYQIALEEVLTWLLSAEDTFQEQDDISDDVEEVKDQFA    281 - 350
THEAFMMELTAHQSSVGSVLQAGNQLITQGTLSDEEEFEIQEQMTLLNARWEALRVESMDRQSRLHDVLM    351 - 420
ELQKKQLQQLSAWLTLTEERIQKMETCPLDDDVKSLQKLLEEHKSLQSDLEAEQVKVNSLTHMVVIVDEN    421 - 490
SGESATAILEDQLQKLGERWTAVCRWTEERWNRLQEINILWQELLEEQCLLKAWLTEKEEALNKVQTSNF    491 - 560
KDQKELSVSVRRLAILKEDMEMKRQTLDQLSEIGQDVGQLLDNSKASKKINSDSEELTQRWDSLVQRLED    561 - 630
SSNQVTQAVAKLGMSQIPQKDLLETVRVREQAITKKSKQELPPPPPPKKRQIHVDIEAKKKFDAISAELL    631 - 700
NWILKWKTAIQTTEIKEYMKMQDTSEMKKKLKALEKEQRERIPRADELNQTGQILVEQMGKEGLPTEEIK    701 - 770
NVLEKVSSEWKNVSQHLEDLERKIQLQEDINAYFKQLDELEKVIKTKEEWVKHTSISESSRQSLPSLKDS    771 - 840
CQRELTNLLGLHPKIEMARASCSALMSQPSAPDFVQRGFDSFLGRYQAVQEAVEDRQQHLENELKGQPGH    841 - 910
AYLETLKTLKDVLNDSENKAQVSLNVLNDLAKVEKALQEKKTLDEILENQKPALHKLAEETKALEKNVHP    911 - 980
DVEKLYKQEFDDVQGKWNKLKVLVSKDLHLLEEIALTLRAFEADSTVIEKWMDGVKDFLMKQQAAQGDDA    981 - 1050
GLQRQLDQCSAFVNEIETIESSLKNMKEIETNLRSGPVAGIKTWVQTRLGDYQTQLEKLSKEIATQKSRL   1051 - 1120
SESQEKAANLKKDLAEMQEWMTQAEEEYLERDFEYKSPEELESAVEEMKRAKEDVLQKEVRVKILKDNIK   1121 - 1190
LLAAKVPSGGQELTSELNVVLENYQLLCNRIRGKCHTLEEVWSCWIELLHYLDLETTWLNTLEERMKSTE   1191 - 1260
VLPEKTDAVNEALESLESVLRHPADNRTQIRELGQTLIDGGILDDIISEKLEAFNSRYEDLSHLAESKQI   1261 - 1330
SLEKQLQVLRETDQMLQVLQESLGELDKQLTTYLTDRIDAFQVPQEAQKIQAEISAHELTLEELRRNMRS   1331 - 1400
QPLTSPESRTARGGSQMDVLQRKLREVSTKFQLFQKPANFEQRMLDCKRVLDGVKAELHVLDVKDVDPDV   1401 - 1470
IQTHLDKCMKLYKTLSEVKLEVETVIKTGRHIVQKQQTDNPKGMDEQLTSLKVLYNDLGAQVTEGKQDLE   1471 - 1540
RASQLARKMKKEAASLSEWLSATETELVQKSTSEGLLGDLDTEISWAKNVLKDLEKRKADLNTITESSAA   1541 - 1610
LQNLIEGSEPILEERLCVLNAGWSRVRTWTEDWCNTLMNHQNQLEIFDGNVAHISTWLYQAEALLDEIEK   1611 - 1680
KPTSKQEEIVKRLVSELDDANLQVENVRDQALILMNARGSSSRELVEPKLAELNRNFEKVSQHIKSAKLL   1681 - 1750
IAQEPLYQCLVTTETFETGVPFSDLEKLENDIENMLKFVEKHLESSDEDEKMDEESAQIEEVLQRGEEML   1751 - 1820
HQPMEDNKKEKIRLQLLLLHTRYNKIKAIPIQQRKMGQLASGIRSSLLPTDYLVEINKILLCMDDVELSL   1821 - 1890
NVPELNTAIYEDFSFQEDSLKNIKDQLDKLGEQIAVIHEKQPDVILEASGPEAIQIRDTLTQLNAKWDRI   1891 - 1960
NRMYSDRKGCFDRAMEEWRQFHCDLNDLTQWITEAEELLVDTCAPGGSLDLEKARIHQQELEVGISSHQP   1961 - 2030
SFAALNRTGDGIVQKLSQADGSFLKEKLAGLNQRWDAIVAEVKDRQPRLKGESKQVMKYRHQLDEIICWL   2031 - 2100
TKAEHAMQKRSTTELGENLQELRDLTQEMEVHAEKLKWLNRTELEMLSDKSLSLPERDKISESLRTVNMT   2101 - 2170
WNKICREVPTTLKECIQEPSSVSQTRIAAHPNVQKVVLVSSASDIPVQSHRTSEISIPADLDKTITELAD   2171 - 2240
WLVLIDQMLKSNIVTVGDVEEINKTVSRMKITKADLEQRHPQLDYVFTLAQNLKNKASSSDMRTAITEKL   2241 - 2310
ERVKNQWDGTQHGVELRQQQLEDMIIDSLQWDDHREETEELMRKYEARLYILQQARRDPLTKQISDNQIL   2311 - 2380
LQELGPGDGIVMAFDNVLQKLLEEYGSDDTRNVKETTEYLKTSWINLKQSIADRQNALEAEWRTVQASRR   2381 - 2450
DLENFLKWIQEAETTVNVLVDASHRENALQDSILARELKQQMQDIQAEIDAHNDIFKSIDGNRQKMVKAL   2451 - 2520
GNSEEATMLQHRLDDMNQRWNDLKAKSASIRAHLEASAEKWNRLLMSLEELIKWLNMKDEELKKQMPIGG   2521 - 2590
DVPALQLQYDHCKALRRELKEKEYSVLNAVDQARVFLADQPIEAPEEPRRNLQSKTELTPEERAQKIAKA   2591 - 2660
MRKQSSEVKEKWESLNAVTSNWQKQVDKALEKLRDLQGAMDDLDADMKEAESVRNGWKPVGDLLIDSLQD   2661 - 2730
HIEKIMAFREEIAPINFKVKTVNDLSSQLSPLDLHPSLKMSRQLDDLNMRWKLLQVSVDDRLKQLQEAHR   2731 - 2800
DFGPSSQHFLSTSVQLPWQRSISHNKVPYYINHQTQTTCWDHPKMTELFQSLADLNNVRFSAYRTAIKIR   2801 - 2870
RLQKALCLDLLELSTTNEIFKQHKLNQNDQLLSVPDVINCLTTTYDGLEQMHKDLVNVPLCVDMCLNWLL   2871 - 2940
NVYDTGRTGKIRVQSLKIGLMSLSKGLLEEKYRYLFKEVAGPTEMCDQRQLGLLLHDAIQIPRQLGEVAA   2941 - 3010
FGGSNIEPSVRSCFQQNNNKPEISVKEFIDWMHLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIVG   3011 - 3080
FRYRSLKHFNYDVCQSCFFSGRTAKGHKLHYPMVEYCIPTTSGEDVRDFTKVLKNKFRSKKYFAKHPRLG   3081 - 3150
YLPVQTVLEGDNLETPITLISMWPEHYDPSQSPQLFHDDTHSRIEQYATRLAQMERTNGSFLTDSSSTTG   3151 - 3220
SVEDEHALIQQYCQTLGGESPVSQPQSPAQILKSVEREERGELERIIADLEEEQRNLQVEYEQLKDQHLR   3221 - 3290
RGLPVGSPPESIISPHHTSEDSELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQPESDS   3291 - 3360
RINGVSPWASPQHSALSYSLDPDASGPQFHQAAGEDLLAPPHDTSTDLTEVMEQIHSTFPSCCPNVPSRP   3361 - 3430
QAM                                                                      3431 - 3433
//

Text Mined References (86)

PMID Year Title
26974331 2016 Correlation of Utrophin Levels with the Dystrophin Protein Complex and Muscle Fibre Regeneration in Duchenne and Becker Muscular Dystrophy Muscle Biopsies.
26516677 2015 The N- and C-Terminal Domains Differentially Contribute to the Structure and Function of Dystrophin and Utrophin Tandem Calponin-Homology Domains.
26015394 2015 Inhibition of muscle fibrosis results in increases in both utrophin levels and the number of revertant myofibers in Duchenne muscular dystrophy.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25434519 2015 Mitochondrial dynamics regulates hypoxia-induced migration and antineoplastic activity of cisplatin in breast cancer cells.
24628267 2014 The actin binding affinity of the utrophin tandem calponin-homology domain is primarily determined by its N-terminal domain.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23937156 2013 Autophagy-mediated turnover of dynamin-related protein 1.
23363418 2013 UtroUp is a novel six zinc finger artificial transcription factor that recognises 18 base pairs of the utrophin promoter and efficiently drives utrophin upregulation.
23345212 2013 Declines in Drp1 and parkin expression underlie DNA damage-induced changes in mitochondrial length and neuronal death.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23163995 2012 A rare microduplication in a familial case of annular pancreas and duodenal stenosis.
22609462 2012 Caveolae and non-caveolae lipid raft microdomains of human umbilical vein endothelial cells contain utrophin-associated protein complexes.
22275054 2012 Thermodynamic stability, unfolding kinetics, and aggregation of the N-terminal actin-binding domains of utrophin and dystrophin.
21677768 2011 Voltage-gated ion channel dysfunction precedes cardiomyopathy development in the dystrophic heart.
21672318 2011 A method of utrophin up-regulation through RNAi-mediated knockdown of the transcription factor EN1.
21482524 2011 [The regulation of UTROPHIN expression by EN1].
21326213 2011 The mitochondrial fission factor dynamin-related protein 1 modulates T-cell receptor signalling at the immune synapse.
21269460 2011 Initial characterization of the human central proteome.
20625423 2010 Dystrophins, utrophins, and associated scaffolding complexes: role in mammalian brain and implications for therapeutic strategies.
20434517 2010 Distribution of dystrophin- and utrophin-associated protein complexes during activation of human neutrophils.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20347265 2010 MicroRNAs and target site screening reveals a pre-microRNA-30e variant associated with schizophrenia.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19945424 2010 The 8th and 9th tandem spectrin-like repeats of utrophin cooperatively form a functional unit to interact with polarity-regulating kinase PAR-1b.
19786618 2009 TAPP2 links phosphoinositide 3-kinase signaling to B-cell adhesion through interaction with the cytoskeletal protein utrophin: expression of a novel cell adhesion-promoting complex in B-cell leukemia.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18945675 2008 Targeting artificial transcription factors to the utrophin A promoter: effects on dystrophic pathology and muscle function.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18468998 2008 Blood pressure is regulated by an alpha1D-adrenergic receptor/dystrophin signalosome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17507653 2007 Ets-2 repressor factor silences extrasynaptic utrophin by N-box mediated repression in skeletal muscle.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16803572 2006 Role of dystrophins and utrophins in platelet adhesion process.
16777071 2006 Interactions of intermediate filament protein synemin with dystrophin and utrophin.
16710609 2006 Role of dystrophin and utrophin for assembly and function of the dystrophin glycoprotein complex in non-muscle tissue.
16598790 2006 Utrophin is a calpain substrate in muscle cells.
16595608 2006 Naturally occurring utrophin correlates with disease severity in Duchenne muscular dystrophy.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16295426 2004 Utility of dystrophin and utrophin staining in childhood muscular dystrophy.
16198105 2005 A and B utrophin in human muscle and sarcolemmal A-utrophin associated with tumours.
16049973 2006 Increased expression of cSHMT, Tbx3 and utrophin in plasma of ovarian and breast cancer patients.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12633873 2003 Ets, Ap-1 and GATA factor families regulate the utrophin B promoter: potential regulatory mechanisms for endothelial-specific expression.
12619170 2003 Relationship between utrophin and regenerating muscle fibers in duchenne muscular dystrophy.
12499352 2002 Spatial and temporal association of Bax with mitochondrial fission sites, Drp1, and Mfn2 during apoptosis.
12370193 2002 Identification of Dp71 isoforms in the platelet membrane cytoskeleton. Potential role in thrombin-mediated platelet adhesion.
12054535 2002 The carboxyterminus of the ATP-binding cassette transporter A1 interacts with a beta2-syntrophin/utrophin complex.
12034776 2002 Laminin-1 redistributes postsynaptic proteins and requires rapsyn, tyrosine phosphorylation, and Src and Fyn to stably cluster acetylcholine receptors.
12006649 2002 Utrophin binds laterally along actin filaments and can couple costameric actin with sarcolemma when overexpressed in dystrophin-deficient muscle.
11997063 2002 Sp1 and the ets-related transcription factor complex GABP alpha/beta functionally cooperate to activate the utrophin promoter.
11875058 2002 The utrophin gene is transcriptionally up-regulated in regenerating muscle.
11861579 2002 Comparative analysis of the human dystrophin and utrophin gene structures.
11796130 2002 Developmentally regulated expression and localization of dystrophin and utrophin in the human fetal brain.
11430802 2001 Specific disruption of a schwann cell dystrophin-related protein complex in a demyelinating neuropathy.
11377836 2001 Dystroglycan distribution in adult mouse brain: a light and electron microscopy study.
11178104 2001 Brain dystrophin-glycoprotein complex: persistent expression of beta-dystroglycan, impaired oligomerization of Dp71 and up-regulation of utrophins in animal models of muscular dystrophy.
10995443 2000 Absence of alpha-syntrophin leads to structurally aberrant neuromuscular synapses deficient in utrophin.
10769203 2000 Adhesion-dependent tyrosine phosphorylation of (beta)-dystroglycan regulates its interaction with utrophin.
10767429 2000 Contribution of the different modules in the utrophin carboxy-terminal region to the formation and regulation of the DAP complex.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10715214 2000 Structure of the utrophin actin-binding domain bound to F-actin reveals binding by an induced fit mechanism.
10647184 1999 Crystal structure of the actin-binding region of utrophin reveals a head-to-tail dimer.
10570192 1999 A second promoter provides an alternative target for therapeutic up-regulation of utrophin in Duchenne muscular dystrophy.
10545507 1999 Different dystrophin-like complexes are expressed in neurons and glia.
10369873 1999 Up71 and up140, two novel transcripts of utrophin that are homologues of short forms of dystrophin.
9887274 1999 The 2.0 A structure of the second calponin homology domain from the actin-binding region of the dystrophin homologue utrophin.
9701558 1998 Characterisation of alpha-dystrobrevin in muscle.
9288751 1997 Utrophin-dystrophin-deficient mice as a model for Duchenne muscular dystrophy.
8977119 1996 Cloning and expression of full length mouse utrophin: the differential association of utrophin and dystrophin with AChR clusters.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8576247 1996 The three human syntrophin genes are expressed in diverse tissues, have distinct chromosomal locations, and each bind to dystrophin and its relatives.
8281135 1993 The utrophin and dystrophin genes share similarities in genomic structure.
7890770 1995 Association of aciculin with dystrophin and utrophin.
7844150 1995 Syntrophin binds to an alternatively spliced exon of dystrophin.
7589238 1995 Localization of utrophin and aciculin at sites of cell-matrix and cell-cell adhesion in cultured cells.
2541343 1989 An autosomal transcript in skeletal muscle with homology to dystrophin.
2203673 1990 Localisation of a dystrophin-related autosomal gene to 6q24 in man, and to mouse chromosome 10 in the region of the dystrophia muscularis (dy) locus.
2014247 1991 Tissue distribution of the dystrophin-related gene product and expression in the mdx and dy mouse.
1461283 1992 Primary structure of dystrophin-related protein.
1426262 1992 Utrophin, the autosomal homologue of dystrophin, is widely-expressed and membrane-associated in cultured cell lines.
1400579 1992 The subcellular distribution of chromosome 6-encoded dystrophin-related protein in the brain.