Property Summary

NCBI Gene PubMed Count 22
PubMed Score 23.25
PubTator Score 12.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
lung cancer 4473 3.7e-05
medulloblastoma, large-cell 6234 1.1e-03
group 3 medulloblastoma 2254 1.9e-03
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Alzheimer's disease 644 0.0 1.0

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell 1.100 1.1e-03
lung cancer 2.100 3.7e-05
group 3 medulloblastoma 1.300 1.9e-03

Synonym

Accession O75691 Q9H3H4
Symbols DRIM
1A6/DRIM

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

Protein-protein Interaction (1)

Gene RIF (4)

PMID Text
21151873 1A6/DRIM activates Pol I transcription most likely by associating with both hALP and UBF and thereby affecting the acetylation of UBF
17498821 DRIM is involved in 18S rRNA processing
16458307 a single region located between amino acids 2744 and 2761 at the C-terminus is capable of nucleolar accumulation. Two basic amino acid clusters within this region are essential for nucleolar accumulation.
14503924 Analysis of the relationship between DRIM gene expression and the metastatic phenotype of breast neoplasms.

AA Sequence

MKTKPVSHKTENTYRFLTFAERLGNVNIDIIHRIDRTASYEEEVETYFFEGLLKWRELNLTEHFGKFYKE      1 - 70
VIDKCQSFNQLVYHQNEIVQSLKTHLQVKNSFAYQPLLDLVVQLARDLQMDFYPHFPEFFLTITSILETQ     71 - 140
DTELLEWAFTSLSYLYKYLWRLMVKDMSSIYSMYSTLLAHKKLHIRNFAAESFTFLMRKVSDKNALFNLM    141 - 210
FLDLDKHPEKVEGVGQLLFEMCKGVRNMFHSCTGQAVKLILRKLGPVTETETQLPWMLIGETLKNMVKST    211 - 280
VSYISKEHFGTFFECLQESLLDLHTKVTKTNCCESSEQIKRLLETYLILVKHGSGTKIPTPADVCKVLSQ    281 - 350
TLQVASLSTSCWETLLDVISALILGENVSLPETLIKETIEKIFESRFEKRLIFSFSEVMFAMKQFEQLFL    351 - 420
PSFLSYIVNCFLIDDAVVKDEALAILAKLILNKAAPPTAGSMAIEKYPLVFSPQMVGFYIKQKKTRSKGR    421 - 490
NEQFPVLDHLLSIIKLPPNKDTTYLSQSWAALVVLPHIRPLEKEKVIPLVTGFIEALFMTVDKGSFGKGN    491 - 560
LFVLCQAVNTLLSLEESSELLHLVPVERVKNLVLTFPLEPSVLLLTDLYYQRLALCGCKGPLSQEALMEL    561 - 630
FPKLQANISTGVSKIRLLTIRILNHFDVQLPESMEDDGLSERQSVFAILRQAELVPATVNDYREKLLHLR    631 - 700
KLRHDVVQTAVPDGPLQEVPLRYLLGMLYINFSALWDPVIELISSHAHEMENKQFWKVYYEHLEKAATHA    701 - 770
EKELQNDMTDEKSVGDESWEQTQEGDVGALYHEQLALKTDCQERLDHTNFRFLLWRALTKFPERVEPRSR    771 - 840
ELSPLFLRFINNEYYPADLQVAPTQDLRRKGKGMVAEEIEEEPAAGDDEELEEEAVPQDESSQKKKTRRA    841 - 910
AAKQLIAHLQVFSKFSNPRALYLESKLYELYLQLLLHQDQMVQKITLDCIMTYKHPHVLPYRENLQRLLE    911 - 980
DRSFKEEIVHFSISEDNAVVKTAHRADLFPILMRILYGRMKNKTGSKTQGKSASGTRMAIVLRFLAGTQP    981 - 1050
EEIQIFLDLLFEPVRHFKNGECHSAVIQAVEDLDLSKVLPLGRQHGILNSLEIVLKNISHLISAYLPKIL   1051 - 1120
QILLCMTATVSHILDQREKIQLRFINPLKNLRRLGIKMVTDIFLDWESYQFRTEEIDAVFHGAVWPQISR   1121 - 1190
LGSESQYSPTPLLKLISIWSRNARYFPLLAKQKPGHPECDILTNVFAILSAKNLSDATASIVMDIVDDLL   1191 - 1260
NLPDFEPTETVLNLLVTGCVYPGIAENIGESITIGGRLILPHVPAILQYLSKTTISAEKVKKKKNRAQVS   1261 - 1330
KELGILSKISKFMKDKEQSSVLITLLLPFLHRGNIAEDTEVDILVTVQNLLKHCVDPTSFLKPIAKLFSV   1331 - 1400
IKNKLSRKLLCTVFETLSDFESGLKYITDVVKLNAFDQRHLDDINFDVRFETFQTITSYIKEMQIVDVNY   1401 - 1470
LIPVMHNCFYNLELGDMSLSDNASMCLMSIIKKLAALNVTEKDYREIIHRSLLEKLRKGLKSQTESIQQD   1471 - 1540
YTTILSCLIQTFPNQLEFKDLVQLTHYHDPEMDFFENMKHIQIHRRARALKKLAKQLMEGKVVLSSKSLQ   1541 - 1610
NYIMPYAMTPIFDEKMLKHENITTAATEIIGAICKHLSWSAYMYYLKHFIHVLQTGQINQKLGVSLLVIV   1611 - 1680
LEAFHFDHKTLEEQMGKIENEENAIEAIELPEPEAMELERVDEEEKEYTCKSLSDNGQPGTPDPADSGGT   1681 - 1750
SAKESECITKPVSFLPQNKEEIERTIKNIQGTITGDILPRLHKCLASTTKREEEHKLVKSKVVNDEEVVR   1751 - 1820
VPLAFAMVKLMQSLPQEVMEANLPSILLKVCALLKNRAQEIRDIARSTLAKIIEDLGVHFLLYVLKELQT   1821 - 1890
TLVRGYQVHVLTFTVHMLLQGLTNKLQVGDLDSCLDIMIEIFNHELFGAVAEEKEVKQILSKVMEARRSK   1891 - 1960
SYDSYEILGKFVGKDQVTKLILPLKEILQNTTSLKLARKVHETLRRITVGLIVNQEMTAESILLLSYGLI   1961 - 2030
SENLPLLTEKEKNPVAPAPDPRLPPQSCLLLPPTPVRGGQKAVVSRKTNMHIFIESGLRLLHLSLKTSKI   2031 - 2100
KSSGECVLEMLDPFVSLLIDCLGSMDVKVITGALQCLIWVLRFPLPSIETKAEQLTKHLFLLLKDYAKLG   2101 - 2170
AARGQNFHLVVNCFKCVTILVKKVKSYQITEKQLQVLLAYAEEDIYDTSRQATAFGLLKAILSRKLLVPE   2171 - 2240
IDEVMRKVSKLAVSAQSEPARVQCRQVFLKYILDYPLGDKLRPNLEFMLAQLNYEHETGRESTLEMIAYL   2241 - 2310
FDTFPQGLLHENCGMFFIPLCLMTINDDSATCKKMASMTIKSLLGKISLEKKDWLFDMVTTWFGAKKRLN   2311 - 2380
RQLAALICGLFVESEGVDFEKRLGTVLPVIEKEIDPENFKDIMEETEEKAADRLLFSFLTLITKLIKECN   2381 - 2450
IIQFTKPAETLSKIWSHVHSHLRHPHNWVWLTAAQIFGLLFASCQPEELIQKWNTKKTKKHLPEPVAIKF   2451 - 2520
LASDLDQKMKSISLASCHQLHSKFLDQSLGEQVVKNLLFAAKVLYLLELYCEDKQSKIKEDLEEQEALED   2521 - 2590
GVACADEKAESDGEEKEEVKEELGRPATLLWLIQKLSRIAKLEAAYSPRNPLKRTCIFKFLGAVAMDLGI   2591 - 2660
DKVKPYLPMIIAPLFRELNSTYSEQDPLLKNLSQEIIELLKKLVGLESFSLAFASVQKQANEKRALRKKR   2661 - 2730
KALEFVTNPDIAAKKKMKKHKNKSEAKKRKIEFLRPGYKAKRQKSHSLKDLAMVE                  2731 - 2785
//

Text Mined References (32)

PMID Year Title
24962325 2014 Genome-wide survival analysis of age at onset of alcohol dependence in extended high-risk COGA families.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21151873 2010 1A6/DRIM, a novel t-UTP, activates RNA polymerase I transcription and promotes cell proliferation.
20197096 2010 Genome-wide analysis reveals novel genes influencing temporal lobe structure with relevance to neurodegeneration in Alzheimer's disease.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17903303 2007 Genome-wide association study for subclinical atherosclerosis in major arterial territories in the NHLBI's Framingham Heart Study.
17652137 2007 Roles of the HEAT repeat proteins Utp10 and Utp20 in 40S ribosome maturation.
17498821 2007 Human 1A6/DRIM, the homolog of yeast Utp20, functions in the 18S rRNA processing.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16541075 2006 The finished DNA sequence of human chromosome 12.
16458307 2006 Mapping nucleolar localization sequences of 1A6/DRIM.
16053918 2005 KIAA0649, a 1A6/DRIM-interacting protein with the oncogenic potential.
15656982 2005 Characterization of the promoter of 1A6/DRIM, a novel cancer-related gene and identification of its transcriptional activator.
15635413 2005 Nucleolar proteome dynamics.
15590835 2004 The small-subunit processome is a ribosome assembly intermediate.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14503924 2003 The interrelationship between DRIM gene expression and cytogenetic and phenotypic characteristics in human breast tumor cell lines.
12837249 2003 A panoramic view of yeast noncoding RNA processing.
12429849 2002 Functional proteomic analysis of human nucleolus.
12150911 2002 90S pre-ribosomes include the 35S pre-rRNA, the U3 snoRNP, and 40S subunit processing factors but predominantly lack 60S synthesis factors.
11790298 2002 Directed proteomic analysis of the human nucleolus.
9673349 Differential gene expression in mammary carcinoma cell lines: identification of DRIM, a new gene down-regulated in metastasis.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.