Property Summary

NCBI Gene PubMed Count 17
PubMed Score 5.09
PubTator Score 3.44

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
diabetes mellitus -1.300 1.1e-03
glioblastoma 1.200 4.6e-07
intraductal papillary-mucinous neoplasm ... 1.500 1.9e-03
medulloblastoma, large-cell 1.100 3.6e-04
ovarian cancer 2.000 4.1e-06
pediatric high grade glioma 1.100 9.7e-06

 GO Function (1)

Gene RIF (1)

AA Sequence

MAGYKPVAIQTYPILGEKITQDTLYWNNYKTPVQIKEFGAVSKVDFSPQPPYNYAVTASSRIHIYGRYSQ      1 - 70
EPIKTFSRFKDTAYCATFRQDGRLLVAGSEDGGVQLFDISGRAPLRQFEGHTKAVHTVDFTADKYHVVSG     71 - 140
ADDYTVKLWDIPNSKEILTFKEHSDYVRCGCASKLNPDLFITGSYDHTVKMFDARTSESVLSVEHGQPVE    141 - 210
SVLLFPSGGLLVSAGGRYVKVWDMLKGGQLLVSLKNHHKTVTCLCLSSSGQRLLSGSLDRKVKVYSTTSY    211 - 280
KVVHSFDYAASILSLALAHEDETIVVGMTNGILSVKHRKSEAKKESLPRRRRPAYRTFIKGKNYMKQRDD    281 - 350
ILINRPAKKHLELYDRDLKHFRISKALDRVLDPTCTIKTPEITVSIIKELNRRGVLANALAGRDEKEISH    351 - 420
VLNFLIRNLSQPRFAPVLINAAEIIIDIYLPVIGQSPVVDKKFLLLQGLVEKEIDYQRELLETLGMMDML    421 - 490
FATMRRKEGTSVLEHTSDGFPENKKIES                                              491 - 518
//

Text Mined References (20)

PMID Year Title