Property Summary

NCBI Gene PubMed Count 28
PubMed Score 74.81
PubTator Score 13.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
Amyotrophic Lateral Sclerosis 1.247 3.6e-05
ovarian cancer -2.100 8.5e-06

Gene RIF (16)

PMID Text
25179595 TRE17/USP6 regulates ubiquitylation and trafficking of cargo proteins that enter cells by clathrin-independent endocytosis
24742829 8 of the 9 giant cell reparative granulomas from hands and feet showed rearrangements of the USP6 gene compared with none of 8 gnathic lesions
23769422 we discuss the clinicopathologic features, molecular pathology, and pathogenesis of ABC and nodular fasciitis in relation to USP6
23748914 identification of a USP6 gene rearrangement is helpful in making a diagnosis of nodular fasciitis.
22188517 manipulating USP6 expression levels alters the ability of cells to migrate and to divide. Cell proliferation and progression through cytokinesis depend on USP6 expression
20418905 TRE17 is sufficient to initiate tumorigenesis, identify MMPs as novel TRE17 effectors that likely contribute to aneurysmal bone cyst pathogenesis.
18265974 No USP6 rearrangements were found in cherubism or brown tumors. USP6 rearrangements were identified in 2 patients with myositis ossificans.
18187620 Knockdown of ubiquitin specific peptidase 6 (USP6) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17701273 The lack of secondary structure of the region flanking the TBC domain in TRE2 may explain why this region plays a role in the lack of GAP activity, even when a potentially functional TBC domain is present.
16127172 Ca2+/CaM has a role in regulating ubiquitination through direct interaction with TRE17
16099424 Tre2 oncogene seems to encode a nonfunctional Rab GAP. As regions flanking the TBC domain may be crucial for catalytic activity
15509780 TRE17 associates directly with Arf6 in its GDP- but not GTP-bound state.
15509545 primary aneurysmal bone cysts are mesenchymal neoplasms exhibiting USP6 and/or CDH11 oncogenic rearrangements
15026324 Deregulated USP6 transcription is associated with aneurysmal bone cyst
14521938 Complementation tests in yeasts indicate that Tre2 codes for a nonfunctional RabGAP.
12612085 TRE17 coprecipitated specifically with the active forms of Cdc42 and Rac1 in vivo. TRE17 is part of a novel effector complex for Cdc42 and Rac1, potentially contributing to their effects on actin remodeling.

AA Sequence

MDMVENADSLQAQERKDILMKYDKGHRAGLPEDKGPEPVGINSSIDRFGILHETELPPVTAREAKKIRRE      1 - 70
MTRTSKWMEMLGEWETYKHSSKLIDRVYKGIPMNIRGPVWSVLLNIQEIKLKNPGRYQIMKERGKRSSEH     71 - 140
IHHIDLDVRTTLRNHVFFRDRYGAKQRELFYILLAYSEYNPEVGYCRDLSHITALFLLYLPEEDAFWALV    141 - 210
QLLASERHSLPGFHSPNGGTVQGLQDQQEHVVPKSQPKTMWHQDKEGLCGQCASLGCLLRNLIDGISLGL    211 - 280
TLRLWDVYLVEGEQVLMPITSIALKVQQKRLMKTSRCGLWARLRNQFFDTWAMNDDTVLKHLRASTKKLT    281 - 350
RKQGDLPPPAKREQGSLAPRPVPASRGGKTLCKGYRQAPPGPPAQFQRPICSASPPWASRFSTPCPGGAV    351 - 420
REDTYPVGTQGVPSLALAQGGPQGSWRFLEWKSMPRLPTDLDIGGPWFPHYDFEWSCWVRAISQEDQLAT    421 - 490
CWQAEHCGEVHNKDMSWPEEMSFTANSSKIDRQKVPTEKGATGLSNLGNTCFMNSSIQCVSNTQPLTQYF    491 - 560
ISGRHLYELNRTNPIGMKGHMAKCYGDLVQELWSGTQKSVAPLKLRRTIAKYAPKFDGFQQQDSQELLAF    561 - 630
LLDGLHEDLNRVHEKPYVELKDSDGRPDWEVAAEAWDNHLRRNRSIIVDLFHGQLRSQVKCKTCGHISVR    631 - 700
FDPFNFLSLPLPMDSYMDLEITVIKLDGTTPVRYGLRLNMDEKYTGLKKQLRDLCGLNSEQILLAEVHDS    701 - 770
NIKNFPQDNQKVQLSVSGFLCAFEIPVPSSPISASSPTQIDFSSSPSTNGMFTLTTNGDLPKPIFIPNGM    771 - 840
PNTVVPCGTEKNFTNGMVNGHMPSLPDSPFTGYIIAVHRKMMRTELYFLSPQENRPSLFGMPLIVPCTVH    841 - 910
TRKKDLYDAVWIQVSWLARPLPPQEASIHAQDRDNCMGYQYPFTLRVVQKDGNSCAWCPQYRFCRGCKID    911 - 980
CGEDRAFIGNAYIAVDWHPTALHLRYQTSQERVVDKHESVEQSRRAQAEPINLDSCLRAFTSEEELGESE    981 - 1050
MYYCSKCKTHCLATKKLDLWRLPPFLIIHLKRFQFVNDQWIKSQKIVRFLRESFDPSAFLVPRDPALCQH   1051 - 1120
KPLTPQGDELSKPRILAREVKKVDAQSSAGKEDMLLSKSPSSLSANISSSPKGSPSSSRKSGTSCPSSKN   1121 - 1190
SSPNSSPRTLGRSKGRLRLPQIGSKNKPSSSKKNLDASKENGAGQICELADALSRGHMRGGSQPELVTPQ   1191 - 1260
DHEVALANGFLYEHEACGNGCGDGYSNGQLGNHSEEDSTDDQREDTHIKPIYNLYAISCHSGILSGGHYI   1261 - 1330
TYAKNPNCKWYCYNDSSCEELHPDEIDTDSAYILFYEQQGIDYAQFLPKIDGKKMADTSSTDEDSESDYE   1331 - 1400
KYSMLQ                                                                   1401 - 1406
//

Text Mined References (29)

PMID Year Title
25179595 2014 TRE17/USP6 regulates ubiquitylation and trafficking of cargo proteins that enter cells by clathrin-independent endocytosis.
24742829 2014 USP6 gene rearrangements occur preferentially in giant cell reparative granulomas of the hands and feet but not in gnathic location.
23769422 2014 USP6-induced neoplasms: the biologic spectrum of aneurysmal bone cyst and nodular fasciitis.
23748914 2013 Detection of USP6 gene rearrangement in nodular fasciitis: an important diagnostic tool.
22188517 2012 The oncogenic TBC domain protein USP6/TRE17 regulates cell migration and cytokinesis.
20418905 2010 TRE17/USP6 oncogene translocated in aneurysmal bone cyst induces matrix metalloproteinase production via activation of NF-kappaB.
19077034 2009 Identification and characterization of a novel Tre-2/Bub2/Cdc16 (TBC) protein that possesses Rab3A-GAP activity.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18265974 2008 Frequency of USP6 rearrangements in myositis ossificans, brown tumor, and cherubism: molecular cytogenetic evidence that a subset of "myositis ossificans-like lesions" are the early phases in the formation of soft-tissue aneurysmal bone cyst.
17701273 2007 Mutational analysis of the TRE2 oncogene encoding an inactive RabGAP.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16555005 2006 The Tre2 oncoprotein, implicated in Ewing's sarcoma, interacts with two components of the cytoskeleton.
16127172 2005 Calcium/calmodulin regulates ubiquitination of the ubiquitin-specific protease TRE17/USP6.
16099424 2005 At least two regions of the oncoprotein Tre2 are involved in its lack of GAP activity.
15735689 2005 Aneurysmal bone cyst variant translocations upregulate USP6 transcription by promoter swapping with the ZNF9, COL1A1, TRAP150, and OMD genes.
15509780 2004 The TBC (Tre-2/Bub2/Cdc16) domain protein TRE17 regulates plasma membrane-endosomal trafficking through activation of Arf6.
15509545 2004 USP6 and CDH11 oncogenes identify the neoplastic cell in primary aneurysmal bone cysts and are absent in so-called secondary aneurysmal bone cysts.
15026324 2004 USP6 (Tre2) fusion oncogenes in aneurysmal bone cyst.
14521938 2003 Expression in a RabGAP yeast mutant of two human homologues, one of which is an oncogene.
12838346 2003 Human and mouse proteases: a comparative genomic approach.
12612085 2003 The TRE17 oncogene encodes a component of a novel effector pathway for Rho GTPases Cdc42 and Rac1 and stimulates actin remodeling.
12604796 2003 The Tre2 (USP6) oncogene is a hominoid-specific gene.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9827704 1998 Deubiquitinating enzymes: a new class of biological regulators.
8471161 1993 Human TRE17 oncogene is generated from a family of homologous polymorphic sequences by single-base changes.
8406013 1993 Identification of novel sequences in the repertoire of hypervariable TRE17 genes from immortalized nonmalignant and malignant human keratinocytes.
8247125 1993 The yeast DOA4 gene encodes a deubiquitinating enzyme related to a product of the human tre-2 oncogene.
1565468 1992 A novel transcriptional unit of the tre oncogene widely expressed in human cancer cells.
1349106 1992 De-novo mutation in hereditary motor and sensory neuropathy type I.