Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.30
PubTator Score 0.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
interstitial lung disease -1.300 3.5e-02
urothelial carcinoma -1.100 2.6e-02
group 3 medulloblastoma -2.000 5.9e-03
medulloblastoma, large-cell -1.800 7.1e-05
acute quadriplegic myopathy 1.369 2.6e-04
adrenocortical adenoma -1.028 3.1e-02
adrenocortical carcinoma -2.213 3.9e-05
non-small cell lung cancer -1.468 3.0e-15
X-linked cerebral adrenoleukodystrophy -1.300 5.0e-02
breast carcinoma -1.200 5.3e-05
interstitial cystitis -1.400 6.6e-04
atypical teratoid/rhabdoid tumor -1.200 2.7e-04
lung adenocarcinoma -1.100 1.1e-11
invasive ductal carcinoma -1.700 1.0e-04
Endometriosis -1.480 1.5e-02
lung carcinoma -1.200 4.7e-10
spina bifida -2.252 4.5e-02
Breast cancer -2.700 1.9e-29
ulcerative colitis 1.600 8.0e-04
ovarian cancer -1.900 8.2e-04
pituitary cancer -2.300 3.4e-05
chronic rhinosinusitis -1.395 2.8e-02
sarcoidosis -1.100 3.8e-02

Synonym

Accession Q70EK8 Q68DA5 Q8WVQ5 Q9P2J7
Symbols

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

PMID Text
20332099 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAWVKFLRKPGGNLGKVYQPGSMLSLAPTKGLLNEPGQNSCFLNSAVQVLWQLDIFRRSLRVLTGHVCQG      1 - 70
DACIFCALKTIFAQFQHSREKALPSDNIRHALAESFKDEQRFQLGLMDDAAECFENMLERIHFHIVPSRD     71 - 140
ADMCTSKSCITHQKFAMTLYEQCVCRSCGASSDPLPFTEFVRYISTTALCNEVERMLERHERFKPEMFAE    141 - 210
LLQAANTTDDYRKCPSNCGQKIKIRRVLMNCPEIVTIGLVWDSEHSDLTEAVVRNLATHLYLPGLFYRVT    211 - 280
DENAKNSELNLVGMICYTSQHYCAFAFHTKSSKWVFFDDANVKEIGTRWKDVVSKCIRCHFQPLLLFYAN    281 - 350
PDGTAVSTEDALRQVISWSHYKSVAENMGCEKPVIHKSDNLKENGFGDQAKQRENQKFPTDNISSSNRSH    351 - 420
SHTGVGKGPAKLSHIDQREKIKDISRECALKAIEQKNLLSSQRKDLEKGQRKDLGRHRDLVDEDLSHFQS    421 - 490
GSPPAPNGFKQHGNPHLYHSQGKGSYKHDRVVPQSRASAQIISSSKSQILAPGEKITGKVKSDNGTGYDT    491 - 560
DSSQDSRDRGNSCDSSSKSRNRGWKPMRETLNVDSIFSESEKRQHSPRHKPNISNKPKSSKDPSFSNWPK    561 - 630
ENPKQKGLMTIYEDEMKQEIGSRSSLESNGKGAEKNKGLVEGKVHGDNWQMQRTESGYESSDHISNGSTN    631 - 700
LDSPVIDGNGTVMDISGVKETVCFSDQITTSNLNKERGDCTSLQSQHHLEGFRKELRNLEAGYKSHEFHP    701 - 770
ESHLQIKNHLIKRSHVHEDNGKLFPSSSLQIPKDHNAREHIHQSDEQKLEKPNECKFSEWLNIENSERTG    771 - 840
LPFHVDNSASGKRVNSNEPSSLWSSHLRTVGLKPETAPLIQQQNIMDQCYFENSLSTECIIRSASRSDGC    841 - 910
QMPKLFCQNLPPPLPPKKYAITSVPQSEKSESTPDVKLTEVFKATSHLPKHSLSTASEPSLEVSTHMNDE    911 - 980
RHKETFQVRECFGNTPNCPSSSSTNDFQANSGAIDAFCQPELDSISTCPNETVSLTTYFSVDSCMTDTYR    981 - 1050
LKYHQRPKLSFPESSGFCNNSLS                                                  1051 - 1073
//

Text Mined References (12)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
23322567 2013 Identification of a candidate gene for astigmatism.
20332099 2010 A systematic gene-based screen of chr4q22-q32 identifies association of a novel susceptibility gene, DKK2, with the quantitative trait of alcohol dependence symptom counts.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15851553 2005 The lacrimal gland transcriptome is an unusually rich source of rare and poorly characterized gene transcripts.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14715245 2004 Cloning and enzymatic analysis of 22 novel human ubiquitin-specific proteases.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10718198 2000 Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro.