Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.54
PubTator Score 0.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
acute quadriplegic myopathy 1.343 1.5e-03
adrenocortical adenoma -1.009 3.2e-02
adrenocortical carcinoma -2.213 3.9e-05
atypical teratoid/rhabdoid tumor -1.200 2.7e-04
Breast cancer -1.200 5.4e-08
breast carcinoma -1.200 5.3e-05
chronic rhinosinusitis -1.395 2.8e-02
Endometriosis -1.424 3.2e-02
group 3 medulloblastoma -1.600 1.1e-02
interstitial cystitis -1.200 3.6e-03
interstitial lung disease -1.200 1.5e-02
invasive ductal carcinoma -1.142 3.1e-02
lung adenocarcinoma -1.100 1.1e-11
lung carcinoma -1.200 4.7e-10
medulloblastoma, large-cell -1.600 3.4e-04
non-small cell lung cancer -1.468 3.0e-15
ovarian cancer -1.300 3.6e-02
pituitary cancer -2.300 3.4e-05
sarcoidosis -1.100 3.8e-02
spina bifida -1.442 4.9e-02
ulcerative colitis 1.500 2.8e-05
urothelial carcinoma -1.100 2.6e-02
X-linked cerebral adrenoleukodystrophy -1.300 5.0e-02

Gene RIF (1)

AA Sequence

MAWVKFLRKPGGNLGKVYQPGSMLSLAPTKGLLNEPGQNSCFLNSAVQVLWQLDIFRRSLRVLTGHVCQG      1 - 70
DACIFCALKTIFAQFQHSREKALPSDNIRHALAESFKDEQRFQLGLMDDAAECFENMLERIHFHIVPSRD     71 - 140
ADMCTSKSCITHQKFAMTLYEQCVCRSCGASSDPLPFTEFVRYISTTALCNEVERMLERHERFKPEMFAE    141 - 210
LLQAANTTDDYRKCPSNCGQKIKIRRVLMNCPEIVTIGLVWDSEHSDLTEAVVRNLATHLYLPGLFYRVT    211 - 280
DENAKNSELNLVGMICYTSQHYCAFAFHTKSSKWVFFDDANVKEIGTRWKDVVSKCIRCHFQPLLLFYAN    281 - 350
PDGTAVSTEDALRQVISWSHYKSVAENMGCEKPVIHKSDNLKENGFGDQAKQRENQKFPTDNISSSNRSH    351 - 420
SHTGVGKGPAKLSHIDQREKIKDISRECALKAIEQKNLLSSQRKDLEKGQRKDLGRHRDLVDEDLSHFQS    421 - 490
GSPPAPNGFKQHGNPHLYHSQGKGSYKHDRVVPQSRASAQIISSSKSQILAPGEKITGKVKSDNGTGYDT    491 - 560
DSSQDSRDRGNSCDSSSKSRNRGWKPMRETLNVDSIFSESEKRQHSPRHKPNISNKPKSSKDPSFSNWPK    561 - 630
ENPKQKGLMTIYEDEMKQEIGSRSSLESNGKGAEKNKGLVEGKVHGDNWQMQRTESGYESSDHISNGSTN    631 - 700
LDSPVIDGNGTVMDISGVKETVCFSDQITTSNLNKERGDCTSLQSQHHLEGFRKELRNLEAGYKSHEFHP    701 - 770
ESHLQIKNHLIKRSHVHEDNGKLFPSSSLQIPKDHNAREHIHQSDEQKLEKPNECKFSEWLNIENSERTG    771 - 840
LPFHVDNSASGKRVNSNEPSSLWSSHLRTVGLKPETAPLIQQQNIMDQCYFENSLSTECIIRSASRSDGC    841 - 910
QMPKLFCQNLPPPLPPKKYAITSVPQSEKSESTPDVKLTEVFKATSHLPKHSLSTASEPSLEVSTHMNDE    911 - 980
RHKETFQVRECFGNTPNCPSSSSTNDFQANSGAIDAFCQPELDSISTCPNETVSLTTYFSVDSCMTDTYR    981 - 1050
LKYHQRPKLSFPESSGFCNNSLS                                                  1051 - 1073
//

Text Mined References (13)

PMID Year Title