Property Summary

NCBI Gene PubMed Count 33
PubMed Score 153.10
PubTator Score 36.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
medulloblastoma, large-cell 6234 1.7e-04
diabetes mellitus 1663 1.1e-03

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.100 1.7e-04
diabetes mellitus -1.100 1.1e-03

Protein-protein Interaction (5)

Gene RIF (12)

PMID Text
25970461 Charge-state distribution and ion mobility analysis revealed that both mono- and tetra-ubiquitin bound to the compact conformation of USP5 only.
25641936 Used IM-MS analysis to study conformational flexibility of the multidomain deubiquitinating enzyme ubiquitin specific protease 5 (USP5).
25207809 A ubiquitin shuttle DC-UbP reconciles protein ubiquitination and deubiquitination via linking UbE1 and USP5 enzymes.
24454762 polyubiquitin chains by USP5 at sites of damage is important for efficient DSB repair
23720098 Cellular isopeptidase T deubiquitinating enzyme disassembles free ubiquitin chains to facilitate KSHV K7 degradation.
23375434 Local administration of NO may prevent neointimal hyperplasia by inhibiting isopeptidase T levels and activity in the vasculature, thereby inhibiting the 26S proteasome in vascular smooth muscle cells.
22283393 USP5 uses multiple zinc fluoride (ZnF)-ubiquitin binding protein (UBP) domains for substrate targeting and core catalytic function.
21976412 Production of the USP5 isoform 2 was strongly correlated with PTBP1 expression in glioblastoma tumor samples and cell lines.
19098288 p53 is selectively stabilized because the unanchored polyubiquitin that accumulates after USP5 knockdown is able to compete with ubiquitinated p53 but not with Mdm2 for proteasomal recognition
16564012 We report the crystal structures of the zinc-finger ubiquitin binding domain (ZnF UBP) from the deubiquitinating enzyme isopeptidase T (IsoT, or USP5) alone and in complex with ubiquitin. This domain is required for optimal catalytic activation of IsoT.
12435595 identification of catalytic site
11771738 Selective upregulation of the ubiquitin-proteasome proteolytic pathway proteins, proteasome zeta chain and isopeptidase T in fetal Down syndrome.

AA Sequence

MAELSEEALLSVLPTIRVPKAGDRVHKDECAFSFDTPESEGGLYICMNTFLGFGKQYVERHFNKTGQRVY      1 - 70
LHLRRTRRPKEEDPATGTGDPPRKKPTRLAIGVEGGFDLSEEKFELDEDVKIVILPDYLEIARDGLGGLP     71 - 140
DIVRDRVTSAVEALLSADSASRKQEVQAWDGEVRQVSKHAFSLKQLDNPARIPPCGWKCSKCDMRENLWL    141 - 210
NLTDGSILCGRRYFDGSGGNNHAVEHYRETGYPLAVKLGTITPDGADVYSYDEDDMVLDPSLAEHLSHFG    211 - 280
IDMLKMQKTDKTMTELEIDMNQRIGEWELIQESGVPLKPLFGPGYTGIRNLGNSCYLNSVVQVLFSIPDF    281 - 350
QRKYVDKLEKIFQNAPTDPTQDFSTQVAKLGHGLLSGEYSKPVPESGDGERVPEQKEVQDGIAPRMFKAL    351 - 420
IGKGHPEFSTNRQQDAQEFFLHLINMVERNCRSSENPNEVFRFLVEEKIKCLATEKVKYTQRVDYIMQLP    421 - 490
VPMDAALNKEELLEYEEKKRQAEEEKMALPELVRAQVPFSSCLEAYGAPEQVDDFWSTALQAKSVAVKTT    491 - 560
RFASFPDYLVIQIKKFTFGLDWVPKKLDVSIEMPEELDISQLRGTGLQPGEEELPDIAPPLVTPDEPKGS    561 - 630
LGFYGNEDEDSFCSPHFSSPTSPMLDESVIIQLVEMGFPMDACRKAVYYTGNSGAEAAMNWVMSHMDDPD    631 - 700
FANPLILPGSSGPGSTSAAADPPPEDCVTTIVSMGFSRDQALKALRATNNSLERAVDWIFSHIDDLDAEA    701 - 770
AMDISEGRSAADSISESVPVGPKVRDGPGKYQLFAFISHMGTSTMCGHYVCHIKKEGRWVIYNDQKVCAS    771 - 840
EKPPKDLGYIYFYQRVAS                                                        841 - 858
//

Text Mined References (44)

PMID Year Title
25970461 2015 Structural insights into interactions between ubiquitin specific protease 5 and its polyubiquitin substrates by mass spectrometry and ion mobility spectrometry.
25641936 2015 Ion mobility-mass spectrometry reveals conformational flexibility in the deubiquitinating enzyme USP5.
25416956 2014 A proteome-scale map of the human interactome network.
25207809 2014 A ubiquitin shuttle DC-UbP/UBTD2 reconciles protein ubiquitination and deubiquitination via linking UbE1 and USP5 enzymes.
24454762 2014 Ubiquitin-specific protease 5 is required for the efficient repair of DNA double-strand breaks.
24424410 2014 USP13 antagonizes gp78 to maintain functionality of a chaperone in ER-associated degradation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23720098 2015 The cellular isopeptidase T deubiquitinating enzyme regulates Kaposi's sarcoma-associated herpesvirus K7 degradation.
23375434 2013 Nitric oxide may inhibit neointimal hyperplasia by decreasing isopeptidase T levels and activity in the vasculature.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22283393 2012 Two ZnF-UBP domains in isopeptidase T (USP5).
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22216260 2011 Domain analysis reveals that a deubiquitinating enzyme USP13 performs non-activating catalysis for Lys63-linked polyubiquitin.
21976412 2012 PTBP1-dependent regulation of USP5 alternative RNA splicing plays a role in glioblastoma tumorigenesis.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19615732 2009 Defining the human deubiquitinating enzyme interaction landscape.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19098288 2009 Suppression of the deubiquitinating enzyme USP5 causes the accumulation of unanchored polyubiquitin and the activation of p53.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18482987 2008 Recognition of polyubiquitin isoforms by the multiple ubiquitin binding modules of isopeptidase T.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16712842 2006 Evidence for distinct functions for human DNA repair factors hHR23A and hHR23B.
16564012 2006 The ubiquitin binding domain ZnF UBP recognizes the C-terminal diglycine motif of unanchored ubiquitin.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
12838346 2003 Human and mouse proteases: a comparative genomic approach.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12435595 2002 Further characterization of the putative human isopeptidase T catalytic site.
12427038 2002 Zinc is required for the catalytic activity of the human deubiquitinating isopeptidase T.
11771738 2001 Selective upregulation of the ubiquitin-proteasome proteolytic pathway proteins, proteasome zeta chain and isopeptidase T in fetal Down syndrome.
11337467 2001 Identification and characterization of the potential promoter regions of 1031 kinds of human genes.
9827704 1998 Deubiquitinating enzymes: a new class of biological regulators.
9074930 1997 Large-scale sequencing in human chromosome 12p13: experimental and computational gene structure determination.
8723724 1996 A gene-rich cluster between the CD4 and triosephosphate isomerase genes at human chromosome 12p13.
7851534 1995 A human de-ubiquitinating enzyme with both isopeptidase and peptidase activities in vitro.
7578059 1995 Metabolism of the polyubiquitin degradation signal: structure, mechanism, and role of isopeptidase T.
7498549 1995 cDNA cloning of a human 100 kDa de-ubiquitinating enzyme: the 100 kDa human de-ubiquitinase belongs to the ubiquitin C-terminal hydrolase family 2 (UCH2).