Property Summary

NCBI Gene PubMed Count 16
PubMed Score 1.71
PubTator Score 2.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Rheumatoid Arthritis 1.100 1.8e-02
astrocytic glioma 1.300 2.0e-02
ependymoma 1.200 4.4e-02
oligodendroglioma -1.400 1.9e-02
osteosarcoma -1.881 2.5e-04
atypical teratoid / rhabdoid tumor 1.100 2.4e-03
glioblastoma -1.100 1.9e-03
medulloblastoma, large-cell -1.300 2.9e-04
adrenocortical carcinoma -1.301 2.1e-05
intraductal papillary-mucinous adenoma (... 1.200 7.1e-04
group 3 medulloblastoma 1.100 2.5e-02
aldosterone-producing adenoma -1.012 4.4e-02
ovarian cancer 1.800 3.5e-05

Gene RIF (4)

PMID Text
25486460 this study demonstrates that USP48 controls the Ubiquitin/proteasome-system-dependent turnover of activated NF-kappaB/RelA in the nucleus.
24308971 data demonstrate a crucial role for the dynamic interaction between D3R and USP48 in the regulation of NHE3 expression and function
16214042 The Overexpression of USP31 in HEK 293T cells inhibited TNFalpha, CD40, LMP1, TRAF2, TRAF6 and IKKbeta-mediated NF-kappaB activation, but did not inhibit Smad-mediated transcription activation.
15354349 Northern blot analysis revealed a single USP31 transcript of approximately 4 kb, which was primarily expressed in the testis and lung.

AA Sequence

MAPRLQLEKAAWRWAETVRPEEVSQEHIETAYRIWLEPCIRGVCRRNCKGNPNCLVGIGEHIWLGEIDEN      1 - 70
SFHNIDDPNCERRKKNSFVGLTNLGATCYVNTFLQVWFLNLELRQALYLCPSTCSDYMLGDGIQEEKDYE     71 - 140
PQTICEHLQYLFALLQNSNRRYIDPSGFVKALGLDTGQQQDAQEFSKLFMSLLEDTLSKQKNPDVRNIVQ    141 - 210
QQFCGEYAYVTVCNQCGRESKLLSKFYELELNIQGHKQLTDCISEFLKEEKLEGDNRYFCENCQSKQNAT    211 - 280
RKIRLLSLPCTLNLQLMRFVFDRQTGHKKKLNTYIGFSEILDMEPYVEHKGGSYVYELSAVLIHRGVSAY    281 - 350
SGHYIAHVKDPQSGEWYKFNDEDIEKMEGKKLQLGIEEDLAEPSKSQTRKPKCGKGTHCSRNAYMLVYRL    351 - 420
QTQEKPNTTVQVPAFLQELVDRDNSKFEEWCIEMAEMRKQSVDKGKAKHEEVKELYQRLPAGAEPYEFVS    421 - 490
LEWLQKWLDESTPTKPIDNHACLCSHDKLHPDKISIMKRISEYAADIFYSRYGGGPRLTVKALCKECVVE    491 - 560
RCRILRLKNQLNEDYKTVNNLLKAAVKGSDGFWVGKSSLRSWRQLALEQLDEQDGDAEQSNGKMNGSTLN    561 - 630
KDESKEERKEEEELNFNEDILCPHGELCISENERRLVSKEAWSKLQQYFPKAPEFPSYKECCSQCKILER    631 - 700
EGEENEALHKMIANEQKTSLPNLFQDKNRPCLSNWPEDTDVLYIVSQFFVEEWRKFVRKPTRCSPVSSVG    701 - 770
NSALLCPHGGLMFTFASMTKEDSKLIALIWPSEWQMIQKLFVVDHVIKITRIEVGDVNPSETQYISEPKL    771 - 840
CPECREGLLCQQQRDLREYTQATIYVHKVVDNKKVMKDSAPELNVSSSETEEDKEEAKPDGEKDPDFNQS    841 - 910
NGGTKRQKISHQNYIAYQKQVIRRSMRHRKVRGEKALLVSANQTLKELKIQIMHAFSVAPFDQNLSIDGK    911 - 980
ILSDDCATLGTLGVIPESVILLKADEPIADYAAMDDVMQVCMPEEGFKGTGLLGH                   981 - 1035
//

Text Mined References (23)

PMID Year Title
25486460 2015 CSN-associated USP48 confers stability to nuclear NF-?B/RelA by trimming K48-linked Ub-chains.
24308971 2014 Dopamine D3 receptor inhibits the ubiquitin-specific peptidase 48 to promote NHE3 degradation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
16214042 2006 Human ubiquitin specific protease 31 is a deubiquitinating enzyme implicated in activation of nuclear factor-kappaB.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15354349 2004 Identification of the human ubiquitin specific protease 31 (USP31) gene: structure, sequence and expression analysis.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14715245 2004 Cloning and enzymatic analysis of 22 novel human ubiquitin-specific proteases.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12838346 2003 Human and mouse proteases: a comparative genomic approach.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9409543 1997 Regulation of ubiquitin-dependent processes by deubiquitinating enzymes.