Property Summary

NCBI Gene PubMed Count 15
PubMed Score 13.94
PubTator Score 8.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
posterior fossa group A ependymoma -1.400 5.8e-07
glioblastoma -1.900 1.8e-05
osteosarcoma 2.003 2.5e-04
group 3 medulloblastoma -2.500 1.0e-03
atypical teratoid / rhabdoid tumor -2.300 7.1e-08
medulloblastoma, large-cell -2.000 3.9e-05
primitive neuroectodermal tumor -1.600 3.7e-07
non-small cell lung cancer 1.169 1.5e-09
intraductal papillary-mucinous adenoma (... 1.500 2.7e-04
lung cancer 1.100 2.6e-02
interstitial cystitis -1.400 3.5e-05
cystic fibrosis -1.100 9.5e-04
adult high grade glioma -1.700 5.9e-04
subependymal giant cell astrocytoma -1.834 3.2e-02
spina bifida -1.544 4.9e-02
pituitary cancer 1.200 9.5e-04

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
651622 other 0 / 0 / 1 Inhibitors of USP1/UAF1: SAR in USP46/UAF1 diubiquitin SDS-PAGE gel assay

Gene RIF (7)

PMID Text
25855980 Results suggest role for USP46/USP12 in Epstein-Barr virus induced growth transformation.
22391563 USP46-mediated stabilization of PHLPP and the subsequent inhibition of Akt.
21663972 results suggest that the USP46 gene might play a role in the pathophysiology of major depressive disorder in the Japanese population.
20111060 Observational study of gene-disease association. (HuGE Navigator)
20111060 These data argue against the presence of any strong genetic susceptibility factors for bipolar disorder or schizophrenia in the region USP46.
19260141 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19075014 two novel multisubunit deubiquitinating enzyme complexes containing USP12 and USP46, respectively. Both complexes contain the UAF1 protein as a bona fide subunit. Interestingly, UAF1

AA Sequence

MTVRNIASICNMGTNASALEKDIGPEQFPINEHYFGLVNFGNTCYCNSVLQALYFCRPFRENVLAYKAQQ      1 - 70
KKKENLLTCLADLFHSIATQKKKVGVIPPKKFISRLRKENDLFDNYMQQDAHEFLNYLLNTIADILQEEK     71 - 140
KQEKQNGKLKNGNMNEPAENNKPELTWVHEIFQGTLTNETRCLNCETVSSKDEDFLDLSVDVEQNTSITH    141 - 210
CLRDFSNTETLCSEQKYYCETCCSKQEAQKRMRVKKLPMILALHLKRFKYMEQLHRYTKLSYRVVFPLEL    211 - 280
RLFNTSSDAVNLDRMYDLVAVVVHCGSGPNRGHYITIVKSHGFWLLFDDDIVEKIDAQAIEEFYGLTSDI    281 - 350
SKNSESGYILFYQSRE                                                          351 - 366
//

Text Mined References (16)

PMID Year Title
26388029 2015 Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
25855980 2015 The EBNA3 family of Epstein-Barr virus nuclear proteins associates with the USP46/USP12 deubiquitination complexes to regulate lymphoblastoid cell line growth.
22391563 2013 The deubiquitination enzyme USP46 functions as a tumor suppressor by controlling PHLPP-dependent attenuation of Akt signaling in colon cancer.
22043315 2011 Lysine 92 amino acid residue of USP46, a gene associated with 'behavioral despair' in mice, influences the deubiquitinating enzyme activity.
21663972 2011 Possible association between ubiquitin-specific peptidase 46 gene and major depressive disorders in the Japanese population.
20111060 2010 Association study of ubiquitin-specific peptidase 46 (USP46) with bipolar disorder and schizophrenia in a Japanese population.
19260141 2009 Genome-wide association study of biochemical traits in Korcula Island, Croatia.
19075014 2009 UAF1 is a subunit of multiple deubiquitinating enzyme complexes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14715245 2004 Cloning and enzymatic analysis of 22 novel human ubiquitin-specific proteases.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12838346 2003 Human and mouse proteases: a comparative genomic approach.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.