Property Summary

NCBI Gene PubMed Count 19
PubMed Score 7.32
PubTator Score 4.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung adenocarcinoma 2714 7.1e-14
atypical teratoid / rhabdoid tumor 4369 6.2e-03
Disease Target Count Z-score Confidence
Mental depression 58 0.0 2.0

Expression

  Differential Expression (2)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.800 6.2e-03
lung adenocarcinoma -1.500 7.1e-14

Gene RIF (6)

PMID Text
26232424 USP44+ Cancer Stem Cell Subclones Contribute to Breast Cancer Aggressiveness by Promoting Vasculogenic Mimicry
24837038 USP44 is epigenetically inactivated in colorectal adenomas, but this alone is not sufficient to cause aneuploidy in colorectal neoplasia.
23615962 findings implicate USP44 in negative regulation of the RNF8/RNF168 pathway
22692537 Data identify Cdc20, USP44, and Wee1 as relevant Fcp1 targets.
21853124 These data are consistent with an important role for USP44 in regulating Cdc20-APC/C activity and suggest that high levels of this enzyme may contribute to the pathogenesis of T-cell leukemias.
17443180 a dynamic balance of ubiquitination by the APC and deubiquitination by USP44 contributes to the generation of the switch-like transition controlling anaphase entry

AA Sequence

MLAMDTCKHVGQLQLAQDHSSLNPQKWHCVDCNTTESIWACLSCSHVACGRYIEEHALKHFQESSHPVAL      1 - 70
EVNEMYVFCYLCDDYVLNDNTTGDLKLLRRTLSAIKSQNYHCTTRSGRFLRSMGTGDDSYFLHDGAQSLL     71 - 140
QSEDQLYTALWHRRRILMGKIFRTWFEQSPIGRKKQEEPFQEKIVVKREVKKRRQELEYQVKAELESMPP    141 - 210
RKSLRLQGLAQSTIIEIVSVQVPAQTPASPAKDKVLSTSENEISQKVSDSSVKRRPIVTPGVTGLRNLGN    211 - 280
TCYMNSVLQVLSHLLIFRQCFLKLDLNQWLAMTASEKTRSCKHPPVTDTVVYQMNECQEKDTGFVCSRQS    281 - 350
SLSSGLSGGASKGRKMELIQPKEPTSQYISLCHELHTLFQVMWSGKWALVSPFAMLHSVWRLIPAFRGYA    351 - 420
QQDAQEFLCELLDKIQRELETTGTSLPALIPTSQRKLIKQVLNVVNNIFHGQLLSQVTCLACDNKSNTIE    421 - 490
PFWDLSLEFPERYQCSGKDIASQPCLVTEMLAKFTETEALEGKIYVCDQCNSKRRRFSSKPVVLTEAQKQ    491 - 560
LMICHLPQVLRLHLKRFRWSGRNNREKIGVHVGFEEILNMEPYCCRETLKSLRPECFIYDLSAVVMHHGK    561 - 630
GFGSGHYTAYCYNSEGGFWVHCNDSKLSMCTMDEVCKAQAYILFYTQRVTENGHSKLLPPELLLGSQHPN    631 - 700
EDADTSSNEILS                                                              701 - 712
//

Text Mined References (22)

PMID Year Title
26232424 2015 USP44+ Cancer Stem Cell Subclones Contribute to Breast Cancer Aggressiveness by Promoting Vasculogenic Mimicry.
24837038 2014 Epigenetic inactivation of the candidate tumor suppressor USP44 is a frequent and early event in colorectal neoplasia.
23615962 2013 The deubiquitylating enzyme USP44 counteracts the DNA double-strand break response mediated by the RNF8 and RNF168 ubiquitin ligases.
22692537 2012 Fcp1-dependent dephosphorylation is required for M-phase-promoting factor inactivation at mitosis exit.
22681888 2012 RNF20 and USP44 regulate stem cell differentiation by modulating H2B monoubiquitylation.
22041458 2012 Pharmacogenomic study of side-effects for antidepressant treatment options in STAR*D.
21853124 2011 Overexpression of ubiquitin specific protease 44 (USP44) induces chromosomal instability and is frequently observed in human T-cell leukemia.
20505756 2010 A data integration approach to mapping OCT4 gene regulatory networks operative in embryonic stem cells and embryonal carcinoma cells.
20402667 2010 K48- and K63-linked polyubiquitination of deubiquitinating enzyme USP44.
17443180 2007 Anaphase initiation is regulated by antagonistic ubiquitination and deubiquitination activities.
16541075 2006 The finished DNA sequence of human chromosome 12.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14715245 2004 Cloning and enzymatic analysis of 22 novel human ubiquitin-specific proteases.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12838346 2003 Human and mouse proteases: a comparative genomic approach.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.