Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.22

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MDGVLFRAHQCQYVHPCVHVYVTVGLMDPLCERKEKASKQERENPLAHLAAWGLVGLHNIGQTCCLNSLI      1 - 70
QVFVMNVDFARILKRITVPRGADEQRRSVPFQMLLLLEKMQDSRQKAVWPLELAYCLQKYNVPLFVQHDA     71 - 140
AQLYLKLWNLIKDQIADVHLVERLQALYMIRMKDSLICLDCAMESSRNSSMLTLRLSFFDVDSKPLKTLE    141 - 210
DALHCFFQPRELSSKSKCFCENCGKKTRGKQVLKLTHLPQTLTIHLMRFSIRNSQTRKICHSLYFPQSLD    211 - 280
FSQILPMKRESCDAEEQSGGQYELFAVIAHVGMADSGHYCVYIRNAVDGKWFCFNDSNICLVSWEDIQCT    281 - 350
YGNPNYHW                                                                  351 - 358
//

Text Mined References (4)

PMID Year Title