Property Summary

NCBI Gene PubMed Count 23
PubMed Score 22.60
PubTator Score 16.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
tuberculosis 1563 7.0e-07
medulloblastoma 1524 8.4e-07
medulloblastoma, large-cell 6234 2.4e-05
glioblastoma 5572 1.6e-04
adrenocortical carcinoma 1427 2.7e-04
osteosarcoma 7933 2.8e-04
ovarian cancer 8491 4.1e-04
Disease Target Count Z-score Confidence
Parkinson's disease 364 0.0 1.0

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -1.310 2.8e-04
glioblastoma 1.200 1.6e-04
medulloblastoma 1.200 8.4e-07
medulloblastoma, large-cell 1.400 2.4e-05
adrenocortical carcinoma -1.102 2.7e-04
tuberculosis -1.800 7.0e-07
ovarian cancer 1.700 4.1e-04

Gene RIF (10)

PMID Text
25775507 USP36 is a crucial and bono fide deubiquitinating enzyme controlling c-Myc's nucleolar degradation pathway
23773437 Recently, much progress has been made in understanding the physiological functions of cytokine-inducible DUBs such as DUB-1, DUB-2, and DUB-3/USP17, in regulation of cell proliferation and apoptosis in lymphocytes. [review]
22865700 The most significantly associated SNPs to type 2 diabetes mellitus in this study are expression SNPs to the lymphocyte antigen 75 gene, the ubiquitin-specific peptidase 36 gene, and the phosphatidylinositol transfer protein, cytoplasmic 1 gene.
22622177 USP36 controls selective autophagy activation in Drosophila and in human cells.
21268071 Study identified a deubiquitinating enzyme USP36 that regulates the protein stability of SOD2.
19679658 Data suggest that nucleophosmin/B23 recruits USP36 to nucleoli, thereby serving as a platform for the regulation of nucleolar protein functions through ubiquitylation/deubiquitylation.
19208757 Results suggest that by deubiquitylating various nucleolar substrate proteins including nucleophosmin/B23 and fibrillarin, USP36 plays a crucial role in regulating the structure and function of nucleoli.
18566677 USP36 is overexpressed in ovarian cancer compared to normal ovary and its transcripts were identified in ascites and serum of ovarian cancer patients
15809067 indentification of deubiquitinating enzyme activity of USP36 by analyzing its capability to cleave the ubiquitin
15254734 DUB-1 is present ubuquitously within cells and has deubiitinating enzyme activity in vivo and in vitro.

AA Sequence

MPIVDKLKEALKPGRKDSADDGELGKLLASSAKKVLLQKIEFEPASKSFSYQLEALKSKYVLLNPKTEGA      1 - 70
SRHKSGDDPPARRQGSEHTYESCGDGVPAPQKVLFPTERLSLRWERVFRVGAGLHNLGNTCFLNATIQCL     71 - 140
TYTPPLANYLLSKEHARSCHQGSFCMLCVMQNHIVQAFANSGNAIKPVSFIRDLKKIARHFRFGNQEDAH    141 - 210
EFLRYTIDAMQKACLNGCAKLDRQTQATTLVHQIFGGYLRSRVKCSVCKSVSDTYDPYLDVALEIRQAAN    211 - 280
IVRALELFVKADVLSGENAYMCAKCKKKVPASKRFTIHRTSNVLTLSLKRFANFSGGKITKDVGYPEFLN    281 - 350
IRPYMSQNNGDPVMYGLYAVLVHSGYSCHAGHYYCYVKASNGQWYQMNDSLVHSSNVKVVLNQQAYVLFY    351 - 420
LRIPGSKKSPEGLISRTGSSSLPGRPSVIPDHSKKNIGNGIISSPLTGKRQDSGTMKKPHTTEEIGVPIS    421 - 490
RNGSTLGLKSQNGCIPPKLPSGSPSPKLSQTPTHMPTILDDPGKKVKKPAPPQHFSPRTAQGLPGTSNSN    491 - 560
SSRSGSQRQGSWDSRDVVLSTSPKLLATATANGHGLKGNDESAGLDRRGSSSSSPEHSASSDSTKAPQTP    561 - 630
RSGAAHLCDSQETNCSTAGHSKTPPSGADSKTVKLKSPVLSNTTTEPASTMSPPPAKKLALSAKKASTLW    631 - 700
RATGNDLRPPPPSPSSDLTHPMKTSHPVVASTWPVHRARAVSPAPQSSSRLQPPFSPHPTLLSSTPKPPG    701 - 770
TSEPRSCSSISTALPQVNEDLVSLPHQLPEASEPPQSPSEKRKKTFVGEPQRLGSETRLPQHIREATAAP    771 - 840
HGKRKRKKKKRPEDTAASALQEGQTQRQPGSPMYRREGQAQLPAVRRQEDGTQPQVNGQQVGCVTDGHHA    841 - 910
SSRKRRRKGAEGLGEEGGLHQDPLRHSCSPMGDGDPEAMEESPRKKKKRKQETQRAVEEDGHLKCPRSAK    911 - 980
PQDAVVPESSSCAPSANGWCPGDRMGLSQAPPVSWNGERESDVVQELLKYSSDKAYGRKVLTWDGKMSAV    981 - 1050
SQDAIEDSRQARTETVVDDWDEEFDRGKEKKIKKFKREKRRNFNAFQKLQTRRNFWSVTHPAKAASLSYR   1051 - 1120
R//

Text Mined References (31)

PMID Year Title
25775507 2015 The nucleolar ubiquitin-specific protease USP36 deubiquitinates and stabilizes c-Myc.
24912190 2014 Genome-wide RNAi screen identifies the Parkinson disease GWAS risk locus SREBF1 as a regulator of mitophagy.
23773437 2013 Molecular mechanisms and functions of cytokine-inducible deubiquitinating enzymes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22865700 2012 Integrating genetic association, genetics of gene expression, and single nucleotide polymorphism set analysis to identify susceptibility Loci for type 2 diabetes mellitus.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22622177 2012 The deubiquitinating enzyme USP36 controls selective autophagy activation by ubiquitinated proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21268071 2011 Protein stability of mitochondrial superoxide dismutase SOD2 is regulated by USP36.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19679658 2009 Nucleophosmin/B23 regulates ubiquitin dynamics in nucleoli by recruiting deubiquitylating enzyme USP36.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19208757 2009 Nucleolar structure and function are regulated by the deubiquitylating enzyme USP36.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18566677 2008 Differential display identifies overexpression of the USP36 gene, encoding a deubiquitinating enzyme, in ovarian cancer.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
15809067 2005 Deubiquitinating enzyme USP36 contains the PEST motif and is polyubiquitinated.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15254734 2004 A novel cysteine protease HeLa DUB-1 responsible for cleaving the ubiquitin in human ovarian cancer cells.
14715245 2004 Cloning and enzymatic analysis of 22 novel human ubiquitin-specific proteases.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12838346 2003 Human and mouse proteases: a comparative genomic approach.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12429849 2002 Functional proteomic analysis of human nucleolus.
10819331 2000 Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.