Property Summary

NCBI Gene PubMed Count 26
PubMed Score 12.74
PubTator Score 20.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis -1.900 1.1e-04
osteosarcoma 1.369 1.2e-05
juvenile dermatomyositis 1.325 1.1e-10
acute quadriplegic myopathy 1.454 1.6e-05
intraductal papillary-mucinous neoplasm ... 1.500 2.8e-02
Pick disease 1.300 1.4e-05
ovarian cancer -1.800 1.1e-05
dermatomyositis 1.200 7.1e-04

 GWAS Trait (1)

Gene RIF (14)

PMID Text
26304236 Data show thata combining cyclin-dependent kinase 2 (CDK2) antagonism and ubiquitin thioesterase 33 (USP33) depletion augments anaphase catastrophe via changes in centrosomal protein of 110 kDa (CP110) protein expression.
25242263 USP33 as a previously unknown tumor-suppressing gene.
24981056 Data show that ubiquitin specific peptidase 33 (USP33) mediates nerve tissue proteins Slit-Robo signaling in lung cancer cell migration.
24855649 Knockdown or chemical inhibition of p97 causes robust accumulation of USP33 due to inhibition of its degradation
24056301 nutrient starvation induces RALB deubiquitylation by accumulation and relocalization of the deubiquitylase USP33 to RALB-positive vesicles
23486064 using human cells, identification of a new mechanism for the regulation of centrosome duplication that requires USP33, a deubiquitinating enzyme that is able to regulate CP110 levels
20724312 Meta-analysis of gene-disease association. (HuGE Navigator)
19706539 Data uncover a previously unknown function of USP33 and reveal a new player in Slit-Robo signaling in cancer cell migration.
19684588 Our results reveal a previously unknown role for USP33 in vertebrate commissural axon guidance and in Slit signaling
19424180 USPs 20 and 33 serve as novel regulators that dictate both post-endocytic sorting as well as the intensity and extent of beta(2)AR signalling from the cell surface.
19363159 USP33 and Mdm2 function reciprocally and favor respectively the stability or lability of the receptor beta-arrestin complex
19118533 VDU1 was identified as a protein partner of hSP56.
17766394 The solution structure of the ZnF UBP domain of USP33 has been determined.
12865408 VDU1 has a role in amplifying the increase in type 2 iodothyronine deiodinase activity that results from catecholamine-stimulated de novo synthesis

AA Sequence

MTGSNSHITILTLKVLPHFESLGKQEKIPNKMSAFRNHCPHLDSVGEITKEDLIQKSLGTCQDCKVQGPN      1 - 70
LWACLENRCSYVGCGESQVDHSTIHSQETKHYLTVNLTTLRVWCYACSKEVFLDRKLGTQPSLPHVRQPH     71 - 140
QIQENSVQDFKIPSNTTLKTPLVAVFDDLDIEADEEDELRARGLTGLKNIGNTCYMNAALQALSNCPPLT    141 - 210
QFFLDCGGLARTDKKPAICKSYLKLMTELWHKSRPGSVVPTTLFQGIKTVNPTFRGYSQQDAQEFLRCLM    211 - 280
DLLHEELKEQVMEVEEDPQTITTEETMEEDKSQSDVDFQSCESCSNSDRAENENGSRCFSEDNNETTMLI    281 - 350
QDDENNSEMSKDWQKEKMCNKINKVNSEGEFDKDRDSISETVDLNNQETVKVQIHSRASEYITDVHSNDL    351 - 420
STPQILPSNEGVNPRLSASPPKSGNLWPGLAPPHKKAQSASPKRKKQHKKYRSVISDIFDGTIISSVQCL    421 - 490
TCDRVSVTLETFQDLSLPIPGKEDLAKLHSSSHPTSIVKAGSCGEAYAPQGWIAFFMEYVKRFVVSCVPS    491 - 560
WFWGPVVTLQDCLAAFFARDELKGDNMYSCEKCKKLRNGVKFCKVQNFPEILCIHLKRFRHELMFSTKIS    561 - 630
THVSFPLEGLDLQPFLAKDSPAQIVTYDLLSVICHHGTASSGHYIAYCRNNLNNLWYEFDDQSVTEVSES    631 - 700
TVQNAEAYVLFYRKSSEEAQKERRRISNLLNIMEPSLLQFYISRQWLNKFKTFAEPGPISNNDFLCIHGG    701 - 770
VPPRKAGYIEDLVLMLPQNIWDNLYSRYGGGPAVNHLYICHTCQIEAEKIEKRRKTELEIFIRLNRAFQK    771 - 840
EDSPATFYCISMQWFREWESFVKGKDGDPPGPIDNTKIAVTKCGNVMLRQGADSGQISEETWNFLQSIYG    841 - 910
GGPEVILRPPVVHVDPDILQAEEKIEVETRSL                                          911 - 942
//

Text Mined References (29)

PMID Year Title
26304236 2015 Specific CP110 Phosphorylation Sites Mediate Anaphase Catastrophe after CDK2 Inhibition: Evidence for Cooperation with USP33 Knockdown.
25242263 2015 USP33 mediates Slit-Robo signaling in inhibiting colorectal cancer cell migration.
24981056 2014 USP33, a new player in lung cancer, mediates Slit-Robo signaling.
24855649 2014 Degradation of the deubiquitinating enzyme USP33 is mediated by p97 and the ubiquitin ligase HERC2.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24056301 2013 The deubiquitylase USP33 discriminates between RALB functions in autophagy and innate immune response.
23486064 2013 USP33 regulates centrosome biogenesis via deubiquitination of the centriolar protein CP110.
21801292 2011 Isoform-specific localization of the deubiquitinase USP33 to the Golgi apparatus.
20724312 2011 Meta-analyses of genes modulating intracellular T3 bio-availability reveal a possible role for the DIO3 gene in osteoarthritis susceptibility.
19832994 2009 Identification of novel androgen-responsive genes by sequencing of LongSAGE libraries.
19706539 2009 Deubiquitinating enzyme USP33/VDU1 is required for Slit signaling in inhibiting breast cancer cell migration.
19699092 2009 Deubiquitinase activities required for hepatocyte growth factor-induced scattering of epithelial cells.
19684588 2009 Midline crossing and Slit responsiveness of commissural axons require USP33.
19424180 2009 The deubiquitinases USP33 and USP20 coordinate beta2 adrenergic receptor recycling and resensitization.
19363159 2009 Beta-arrestin-dependent signaling and trafficking of 7-transmembrane receptors is reciprocally regulated by the deubiquitinase USP33 and the E3 ligase Mdm2.
19118533 2009 Human selenium binding protein-1 (hSP56) interacts with VDU1 in a selenium-dependent manner.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17766394 2007 The solution structure of the ZnF UBP domain of USP33/VDU1.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15996926 2005 A leukemia-enriched cDNA microarray platform identifies new transcripts with relevance to the biology of pediatric acute lymphoblastic leukemia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12865408 2003 Deubiquitination of type 2 iodothyronine deiodinase by von Hippel-Lindau protein-interacting deubiquitinating enzymes regulates thyroid hormone activation.
12838346 2003 Human and mouse proteases: a comparative genomic approach.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12056827 2002 Identification of a deubiquitinating enzyme subfamily as substrates of the von Hippel-Lindau tumor suppressor.
11739384 2002 Ubiquitination of a novel deubiquitinating enzyme requires direct binding to von Hippel-Lindau tumor suppressor protein.
10470851 1999 Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.