Property Summary

NCBI Gene PubMed Count 23
PubMed Score 32.73
PubTator Score 38.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Gene RIF (23)

PMID Text
25755145 Evidence from both enzymatic and meta-analyses does not support a direct association between USP26 variants and male infertility
24875820 There is an association of alteration in USP26 with male infertility, especially in azoospermia and in the Asian population. [Meta-Analysis]
23779098 there is a significant difference in USP26 gene expression between the obstructive azoospermia, complete maturation arrest samples and Sertoli Cell-Only Syndrome samples
22568204 The nucleotide polymorphisms of the Usp26 gene might be closely related with idiopathic male infertility, and exert a negative effect on the testis function.
21147082 results indicated the variation of USP26 was not directly associated with human sperm count but suggested it might be a potential role in sperm motility
20501646 USP26 assembles with androgen receptors (AR)and other cofactors in subnuclear foci and serves to counteract hormone-induced AR ubiquitination, thereby contributing to the regulation of AR transcriptional activity.
20378615 Observational study of gene-disease association. (HuGE Navigator)
18958354 Some USP26 alleles and haplotypes are associated with spermatogenic defect in the Han nationality in Taiwan
18958354 Observational study of gene-disease association. (HuGE Navigator)
18927127 Mutation within the USP26 gene is associated with risk of inguinal hernia leading to impaired male fertility.
18927127 Observational study of gene-disease association. (HuGE Navigator)
18377898 Mutations of the USP26 gene do not appear to be a common cause of idiopathic azoospermia or severe oligozoospermia.
18377898 Observational study of gene-disease association. (HuGE Navigator)
18187620 Knockdown of ubiquitin specific peptidase 26 (USP26) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18062861 Meta-analysis of gene-disease association. (HuGE Navigator)
17968467 Observational study of gene-disease association. (HuGE Navigator)
17968467 The USP26 gene might be of importance in male reproduction. Mutations in this gene might be associated with male infertility, and might negatively affect testicular function.
17121659 Sequencing can confirm the presence of the three changes of the USP26 gene in patients of Caucasian origin with cryptozoospermia or oligozoospermia.
16888075 USP26 haplotype is present in significant frequencies in sub-Saharan African and South and East Asian populations, including in individuals with known fertility. This indicates that the allele is not associated with infertility.
15970005 Observational study of gene-disease association. (HuGE Navigator)
15970005 The USP26 gene may be of importance in male reproduction. Mutations in this gene may be associated with male infertility, and may negatively affect testicular function.
15562280 Observational study of gene-disease association. (HuGE Navigator)
15562280 Alterations in the USP26 gene may be involved in male infertility or might increase the risk of male infertility. These patients showed 370-371insACA, 494T>C and 1423C>T causing T123-124ins, L165S and H475Y, respectively

AA Sequence

MAALFLRGFVQIGNCKTGISKSKEAFIEAVERKKKDRLVLYFKSGKYSTFRLSDNIQNVVLKSYRGNQNH      1 - 70
LHLTLQNNNGLFIEGLSSTDAEQLKIFLDRVHQNEVQPPVRPGKGGSVFSSTTQKEINKTSFHKVDEKSS     71 - 140
SKSFEIAKGSGTGVLQRMPLLTSKLTLTCGELSENQHKKRKRMLSSSSEMNEEFLKENNSVEYKKSKADC    141 - 210
SRCVSYNREKQLKLKELEENKKLECESSCIMNATGNPYLDDIGLLQALTEKMVLVFLLQQGYSDGYTKWD    211 - 280
KLKLFFELFPEKICHGLPNLGNTCYMNAVLQSLLSIPSFADDLLNQSFPWGKIPLNALTMCLARLLFFKD    281 - 350
TYNIEIKEMLLLNLKKAISAAAEIFHGNAQNDAHEFLAHCLDQLKDNMEKLNTIWKPKSEFGEDNFPKQV    351 - 420
FADDPDTSGFSCPVITNFELELLHSIACKACGQVILKTELNNYLSINLPQRIKAHPSSIQSTFDLFFGAE    421 - 490
ELEYKCAKCEHKTSVGVHSFSRLPRILIVHLKRYSLNEFCALKKNDQEVIISKYLKVSSHCNEGTRPPLP    491 - 560
LSEDGEITDFQLLKVIRKMTSGNISVSWPATKESKDILAPHIGSDKESEQKKGQTVFKGASRRQQQKYLG    561 - 630
KNSKPNELESVYSGDRAFIEKEPLAHLMTYLEDTSLCQFHKAGGKPASSPGTPLSKVDFQTVPENPKRKK    631 - 700
YVKTSKFVAFDRIINPTKDLYEDKNIRIPERFQKVSEQTQQCDGMRICEQAPQQALPQSFPKPGTQGHTK    701 - 770
NLLRPTKLNLQKSNRNSLLALGSNKNPRNKDILDKIKSKAKETKRNDDKGDHTYRLISVVSHLGKTLKSG    771 - 840
HYICDAYDFEKQIWFTYDDMRVLGIQEAQMQEDRRCTGYIFFYMHNEIFEEMLKREENAQLNSKEVEETL    841 - 910
QKE                                                                       911 - 913
//

Text Mined References (23)

PMID Year Title
25755145 2015 Evidence from enzymatic and meta-analyses does not support a direct association between USP26 gene variants and male infertility.
24875820 Association of 370-371insACA, 494T>C, and 1423C>T haplotype in ubiquitin-specific protease 26 gene and male infertility: a meta-analysis.
23779098 2013 Ubiquitin-specific protease (USP26) gene alterations associated with male infertility and recurrent pregnancy loss (RPL) in Iranian infertile patients.
22568204 2012 [Polymorphism of Usp26 correlates with idiopathic male infertility].
21147082 2011 Association between ubiquitin-specific protease USP26 polymorphism and male infertility in Chinese men.
20501646 2010 The deubiquitinating enzyme USP26 is a regulator of androgen receptor signaling.
20378615 2010 Evaluation of 172 candidate polymorphisms for association with oligozoospermia or azoospermia in a large cohort of men of European descent.
19615732 2009 Defining the human deubiquitinating enzyme interaction landscape.
18958354 2008 Association of USP26 haplotypes in men in Taiwan, China with severe spermatogenic defect.
18927127 2009 USP26 gene variations in fertile and infertile men.
18377898 2008 Sequence analysis of the X-linked USP26 gene in severe male factor infertility patients and fertile controls.
18062861 2007 Gene polymorphisms and male infertility--a meta-analysis and literature review.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17968467 2007 Novel mutations in ubiquitin-specific protease 26 gene might cause spermatogenesis impairment and male infertility.
17121659 2006 Alterations of the USP26 gene in Caucasian men.
16888075 2006 Haplotypes, mutations and male fertility: the story of the testis-specific ubiquitin protease USP26.
15970005 2005 Novel mutations in testis-specific ubiquitin protease 26 gene may cause male infertility and hypogonadism.
15772651 2005 The DNA sequence of the human X chromosome.
15562280 2005 Possible role of USP26 in patients with severely impaired spermatogenesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12838346 2003 Human and mouse proteases: a comparative genomic approach.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11279525 2001 An abundance of X-linked genes expressed in spermatogonia.