Property Summary

NCBI Gene PubMed Count 15
PubMed Score 43.63
PubTator Score 38.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8491 2.4e-06
malignant mesothelioma 3163 1.7e-05
lung cancer 4473 3.8e-05

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.100 1.7e-05
lung cancer 2.100 3.8e-05
ovarian cancer 1.700 2.4e-06

Protein-protein Interaction (7)

Gene RIF (6)

PMID Text
26100909 Data show that SUMOylated BANP, E5R, and Nac1 (BEN) domain 3 (BEND3) stabilizes NoRC component TTF-1-interacting protein 5 (Tip5)via association with ubiquitin specific protease 21 (USP21) debiquitinase
25197364 The protein stability of IL-33 is maintained by USP21 through deubiquitination
23395819 Identification of the E3 deubiquitinase ubiquitin-specific peptidase 21 (USP21) as a positive regulator of the transcription factor GATA3
22298430 Study observed a reduction in the number of A549 cells developing a primary cilium upon serum starvation when USP21 was depleted with two independent siRNA oligos.
21399617 Study report that USP21 cleaves Ub polymers, and with reduced activity also targets ISG15, but is inactive against NEDD8.
19910467 USP21 plays an important role in the down-regulation of TNFalpha-induced NF-kappaB activation through deubiquitinating RIP1.

AA Sequence

MPQASEHRLGRTREPPVNIQPRVGSKLPFAPRARSKERRNPASGPNPMLRPLPPRPGLPDERLKKLELGR      1 - 70
GRTSGPRPRGPLRADHGVPLPGSPPPTVALPLPSRTNLARSKSVSSGDLRPMGIALGGHRGTGELGAALS     71 - 140
RLALRPEPPTLRRSTSLRRLGGFPGPPTLFSIRTEPPASHGSFHMISARSSEPFYSDDKMAHHTLLLGSG    141 - 210
HVGLRNLGNTCFLNAVLQCLSSTRPLRDFCLRRDFRQEVPGGGRAQELTEAFADVIGALWHPDSCEAVNP    211 - 280
TRFRAVFQKYVPSFSGYSQQDAQEFLKLLMERLHLEINRRGRRAPPILANGPVPSPPRRGGALLEEPELS    281 - 350
DDDRANLMWKRYLEREDSKIVDLFVGQLKSCLKCQACGYRSTTFEVFCDLSLPIPKKGFAGGKVSLRDCF    351 - 420
NLFTKEEELESENAPVCDRCRQKTRSTKKLTVQRFPRILVLHLNRFSASRGSIKKSSVGVDFPLQRLSLG    421 - 490
DFASDKAGSPVYQLYALCNHSGSVHYGHYTALCRCQTGWHVYNDSRVSPVSENQVASSEGYVLFYQLMQE    491 - 560
PPRCL                                                                     561 - 565
//

Text Mined References (20)

PMID Year Title
26100909 2015 BEND3 represses rDNA transcription by stabilizing a NoRC component via USP21 deubiquitinase.
25416956 2014 A proteome-scale map of the human interactome network.
25197364 2014 Deubiquitination and stabilization of IL-33 by USP21.
23395819 2013 Identification of the E3 deubiquitinase ubiquitin-specific peptidase 21 (USP21) as a positive regulator of the transcription factor GATA3.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22298430 2012 Systematic survey of deubiquitinase localization identifies USP21 as a regulator of centrosome- and microtubule-associated functions.
21888622 2012 A global survey of CRM1-dependent nuclear export sequences in the human deubiquitinase family.
21399617 2011 Polyubiquitin binding and cross-reactivity in the USP domain deubiquitinase USP21.
19910467 2010 Ubiquitin-specific peptidase 21 inhibits tumor necrosis factor alpha-induced nuclear factor kappaB activation via binding to and deubiquitinating receptor-interacting protein 1.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231747 2004 A protein interaction framework for human mRNA degradation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10799498 2000 Identification of a novel isopeptidase with dual specificity for ubiquitin- and NEDD8-conjugated proteins.
10786635 2000 Sequencing, tissue distribution and chromosomal assignment of a novel ubiquitin-specific protease USP23.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.