Property Summary

NCBI Gene PubMed Count 17
PubMed Score 0.00

Knowledge Summary


No data available

AA Sequence

STTPTHQESMNTGTLASLRGRARRSKGKNKHSKRALLVCQ                                  491 - 530

Text Mined References (18)

PMID Year Title
21448158 2011 The deubiquitinating enzyme USP17 is essential for GTPase subcellular localization and cell motility.
21239494 2011 Lys-63-specific deubiquitination of SDS3 by USP17 regulates HDAC activity.
20715989 2010 Polyclonal and monoclonal antibodies specific for USP17, a proapoptotic deubiquitinating enzyme.
20403174 2010 The DUB/USP17 deubiquitinating enzymes: a gene family within a tandemly repeated sequence, is also embedded within the copy number variable beta-defensin cluster.
20388806 2010 The deubiquitinating enzyme USP17 is highly expressed in tumor biopsies, is cell cycle regulated, and is required for G1-S progression.
20368735 2010 The ubiquitin-specific protease 17 is involved in virus-triggered type I IFN signaling.
20228808 2010 Ubiquitin hydrolase Dub3 promotes oncogenic transformation by stabilizing Cdc25A.
20228807 2010 Cdc25A and Dub3 in a high-stakes balancing act.
20147298 2010 The deubiquitinating enzyme USP17 blocks N-Ras membrane trafficking and activation but leaves K-Ras unaffected.
19188362 2009 USP17 regulates Ras activation and cell proliferation by blocking RCE1 activity.
17109758 2006 Hyaluronan- and RNA-binding deubiquitinating enzymes of USP17 family members associated with cell viability.
16611142 2006 Cytokine-regulated protein degradation by the ubiquitination system.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15780755 2005 The DUB/USP17 deubiquitinating enzymes, a multigene family within a tandemly repeated sequence.
14699124 2004 DUB-3, a cytokine-inducible deubiquitinating enzyme that blocks proliferation.
11941478 2002 Unstable transmission of the RS447 human megasatellite tandem repetitive sequence that contains the USP17 deubiquitinating enzyme gene.
10936051 2000 The RS447 human megasatellite tandem repetitive sequence encodes a novel deubiquitinating enzyme with a functional promoter.
9806828 1998 Human megasatellite DNA RS447: copy-number polymorphisms and interspecies conservation.