Property Summary

NCBI Gene PubMed Count 34
PubMed Score 36.80
PubTator Score 23.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Waldenstrons macroglobulinemia -1.267 1.1e-02
urothelial carcinoma -1.100 3.5e-03
malignant mesothelioma -1.500 2.5e-07
osteosarcoma -3.464 9.3e-08
posterior fossa group B ependymoma 2.100 1.4e-12
glioblastoma 2.100 4.3e-08
atypical teratoid / rhabdoid tumor -2.000 2.5e-07
medulloblastoma 1.200 8.6e-04
medulloblastoma, large-cell -1.800 7.2e-07
primitive neuroectodermal tumor 1.300 3.4e-03
hereditary spastic paraplegia -1.071 4.1e-03
Atopic dermatitis -1.300 1.3e-05
lung cancer -1.300 2.4e-04
adult high grade glioma 1.800 1.9e-05
pilocytic astrocytoma 1.500 8.2e-07
ovarian cancer -1.100 9.1e-07

Protein-protein Interaction (7)

Gene RIF (21)

PMID Text
26435193 SMURF2 is a critical target of USP15 in the TGF-beta signaling pathway.
26061460 our data demonstrate that USP15 acts as a negative regulator of RIG-I signaling via DUB-dependent and independent mechanisms.
24939309 Data suggest that ubiquitin specific peptidase 15 (USP15) may play a role in the pathogenesis of psoriasis through regulating the type I TGFbeta receptor (TbetaR-I)/Smad7 pathway.
24852371 These data identify USP15 as an antagonist of Parkin and suggest that USP15 inhibition could be a therapeutic strategy for PD cases caused by reduced Parkin levels.
24850914 Data show that USP15 enhances BMP-induced phosphorylation of SMAD1 by interacting with and deubiquitylating ALK3.
24777531 USP15 deficiency promoted T cell activation in vitro and enhanced T cell responses to bacterial infection and tumor challenge in vivo.
24526689 SART3 recruits ubH2B, which may be evicted from DNA during transcription, for deubiquitination by Usp15
24399297 Data indicate ubiquitin-specific protease 15 (USP15) as a critical regulator of the tripartite motif protein 25 (TRIM25)- and RNA sensor retinoic acid-inducible gene-I (RIG-I)-mediated antiviral immune response.
23727018 USP15 specifically deubiquitinates Keap1, which suppresses the Nrf2 pathway.
23708518 The deubiquitylase USP15 stabilizes newly synthesized REST and rescues its expression at mitotic exit.
23105109 The dominant effect of prolonged USP15 depletion upon signal amplitude is due to a decrease in CRAF levels while allowing for the possibility that USP15 may also function to dampen MAPK signaling through direct stabilization of BRAP.
22344298 Our results show that USP15 regulates the TGF-beta pathway and is a key factor in glioblastoma pathogenesis
22001210 structure of the double domain from USP15
21947082 USP15 is critical for the occupancy of endogenous target promoters by the SMAD complex.
21848306 A 1.5 A resolution crystal structure of the human USP15 N-terminal domain revealed a 80 A elongated arrangement with the domains aligned in tandem.
21219870 These results indicate that USP15 is involved in the regulation of hypertrophic responses in cardiac muscle through transcriptional and post-translational modulation of SLIM1.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19576224 Results suggest a role of COP9 signalosome (CSN)-mediated deneddylation in the formation of the beta-catenin-degrading supercomplex and the protection of complex-bound adenomatous polyposis coli via CSN-associated USP15.
19553310 These results implicate USP15 directly in the regulation of E6 protein stability and suggest that ubiquitylated E6 could be a substrate for USP15 ubiquitin peptidase activity.
16298993 analysis of the human ubiquitin-specific protease 15 DUSP domain
16005295 A functional Zn finger of USP15 is needed to maintain a conformation essential for disassembling poly-Ub chains, a prerequisite for rescuing the E3 ligase Rbx1.

AA Sequence

MAEGGAADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNVYPGPIDNSGL      1 - 70
LKDGDAQSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQGMFVKHCKVEVYLTELKLCE     71 - 140
NGNMNNVVTRRFSKADTIDTIEKEIRKIFSIPDEKETRLWNKYMSNTFEPLNKPDSTIQDAGLYQGQVLV    141 - 210
IEQKNEDGTWPRGPSTPKSPGASNFSTLPKISPSSLSNNYNNMNNRNVKNSNYCLPSYTAYKNYDYSEPG    211 - 280
RNNEQPGLCGLSNLGNTCFMNSAIQCLSNTPPLTEYFLNDKYQEELNFDNPLGMRGEIAKSYAELIKQMW    281 - 350
SGKFSYVTPRAFKTQVGRFAPQFSGYQQQDCQELLAFLLDGLHEDLNRIRKKPYIQLKDADGRPDKVVAE    351 - 420
EAWENHLKRNDSIIVDIFHGLFKSTLVCPECAKISVTFDPFCYLTLPLPMKKERTLEVYLVRMDPLTKPM    421 - 490
QYKVVVPKIGNILDLCTALSALSGIPADKMIVTDIYNHRFHRIFAMDENLSSIMERDDIYVFEININRTE    491 - 560
DTEHVIIPVCLREKFRHSSYTHHTGSSLFGQPFLMAVPRNNTEDKLYNLLLLRMCRYVKISTETEETEGS    561 - 630
LHCCKDQNINGNGPNGIHEEGSPSEMETDEPDDESSQDQELPSENENSQSEDSVGGDNDSENGLCTEDTC    631 - 700
KGQLTGHKKRLFTFQFNNLGNTDINYIKDDTRHIRFDDRQLRLDERSFLALDWDPDLKKRYFDENAAEDF    701 - 770
EKHESVEYKPPKKPFVKLKDCIELFTTKEKLGAEDPWYCPNCKEHQQATKKLDLWSLPPVLVVHLKRFSY    771 - 840
SRYMRDKLDTLVDFPINDLDMSEFLINPNAGPCRYNLIAVSNHYGGMGGGHYTAFAKNKDDGKWYYFDDS    841 - 910
SVSTASEDQIVSKAAYVLFYQRQDTFSGTGFFPLDRETKGASAATGIPLESDEDSNDNDNDIENENCMHT    911 - 980
N//

Text Mined References (49)

PMID Year Title
26435193 2015 USP15 regulates SMURF2 kinetics through C-lobe mediated deubiquitination.
26061460 2015 Ubiquitin-specific Protease 15 Negatively Regulates Virus-induced Type I Interferon Signaling via Catalytically-dependent and -independent Mechanisms.
25416956 2014 A proteome-scale map of the human interactome network.
24939309 2014 Expression of USP15, T?R-I and Smad7 in psoriasis.
24852371 2014 The deubiquitinase USP15 antagonizes Parkin-mediated mitochondrial ubiquitination and mitophagy.
24850914 2014 USP15 targets ALK3/BMPR1A for deubiquitylation to enhance bone morphogenetic protein signalling.
24777531 2014 USP15 stabilizes MDM2 to mediate cancer-cell survival and inhibit antitumor T cell responses.
24526689 2014 The U4/U6 recycling factor SART3 has histone chaperone activity and associates with USP15 to regulate H2B deubiquitination.
24399297 2014 The ubiquitin-specific protease USP15 promotes RIG-I-mediated antiviral signaling by deubiquitylating TRIM25.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23727018 2013 USP15 negatively regulates Nrf2 through deubiquitination of Keap1.
23708518 2013 The deubiquitylase USP15 stabilizes newly synthesized REST and rescues its expression at mitotic exit.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23105109 2012 Direct and indirect control of mitogen-activated protein kinase pathway-associated components, BRAP/IMP E3 ubiquitin ligase and CRAF/RAF1 kinase, by the deubiquitylating enzyme USP15.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22424883 2012 Genome-wide association study of lung function decline in adults with and without asthma.
22344298 2012 USP15 stabilizes TGF-? receptor I and promotes oncogenesis through the activation of TGF-? signaling in glioblastoma.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22001210 2011 Structural variability of the ubiquitin specific protease DUSP-UBL double domains.
21947082 2011 USP15 is a deubiquitylating enzyme for receptor-activated SMADs.
21848306 2011 Structure of the USP15 N-terminal domains: a ?-hairpin mediates close association between the DUSP and UBL domains.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21219870 2011 Transgenic overexpression of USP15 in the heart induces cardiac remodeling in mice.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19826004 2009 COP9 signalosome interacts ATP-dependently with p97/valosin-containing protein (VCP) and controls the ubiquitination status of proteins bound to p97/VCP.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19665996 2009 USP15 plays an essential role for caspase-3 activation during Paclitaxel-induced apoptosis.
19576224 2009 The COP9 signalosome mediates beta-catenin degradation by deneddylation and blocks adenomatous polyposis coli destruction via USP15.
19553310 2009 The ubiquitin-specific peptidase USP15 regulates human papillomavirus type 16 E6 protein stability.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17318178 2007 CSN controls NF-kappaB by deubiquitinylation of IkappaBalpha.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16541075 2006 The finished DNA sequence of human chromosome 12.
16298993 2006 Solution structure of the human ubiquitin-specific protease 15 DUSP domain.
16005295 2005 The zinc finger of the CSN-associated deubiquitinating enzyme USP15 is essential to rescue the E3 ligase Rbx1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12838346 2003 Human and mouse proteases: a comparative genomic approach.
12532266 2003 Isolation and characterization of the mouse ubiquitin-specific protease Usp15.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
10444327 1999 Identification, functional characterization, and chromosomal localization of USP15, a novel human ubiquitin-specific protease related to the UNP oncoprotein, and a systematic nomenclature for human ubiquitin-specific proteases.
9827704 1998 Deubiquitinating enzymes: a new class of biological regulators.
9628581 1998 Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.