Property Summary

NCBI Gene PubMed Count 32
PubMed Score 65.43
PubTator Score 45.96

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.200 2.6e-02
ependymoma -1.200 4.4e-02
psoriasis 1.200 7.0e-04
osteosarcoma 2.095 8.1e-07
intraductal papillary-mucinous neoplasm ... 1.400 9.7e-03
lung cancer 1.200 7.6e-03
adult high grade glioma -1.100 6.1e-04
inflammatory breast cancer 1.100 1.6e-04
ovarian cancer 1.800 6.8e-05

Gene RIF (19)

PMID Text
27074503 USP14 shows a marked preference for ubiquitin-cyclin B conjugates that carry more than one ubiquitin modification or chain
26817839 Cell surface ubiquitination precedes endocytosis, after which USP14 acts as an ubiquitin-binding protein that targets the ubiquitinated GABA B receptor to lysosomal degradation and promotes its deubiquitination.
26712154 Increased USP14 expression in patients with breast cancer was associated with a poorer prognosis.
26523394 Akt-mediated phosphorylation of USP14 at Ser432, which normally blocks its catalytic site in the inactive conformation, activates its deubiquitinating activity in vitro and in cells.
26397990 our findings suggested that USP14 is involved in the progression of hepatocellular carcinoma(HCC) and may be a useful therapeutic target in HCC
25429837 our findings suggest that USP14 is involved in the progression of epithelial ovarian cancer
24556800 MiR-4782-3p inhibited cell proliferation in NSCLC by targeting USP14, ZEB2 and XIAP.
24319254 b-AP15 is an inhibitor of deubiquitylating enzyme USP14 and UCHL5 induces apoptosis in multiple myeloma and overcomes bortezomib resistance.
23702845 Downregulation of USP14 expression arrested the cell cycle, which may be related to beta-catenin degradation.
23615914 overexpression of HA-USP14 increased the LPS-, TNFalpha-, or Escherichia coli-induced IL-8 release in human lung epithelial cells.
23291607 the decrease in proteolysis of proteasomal substrates during aging is independent of the increased USP14 activity and that the reciprocal regulation of USP14 and proteasomal catalytic activity may be necessary to maintain cellular ubiquitin homeostasis.
21627382 High Ubiquitin-specific protease 14 expression associated with intrahepatic cholangiocarcinoma cell differentiation.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19726649 Data from transgenic mice define a critical role for Usp14 at mammalian synapses and suggest a requirement for local ubiquitin recycling by the proteasome to control the development and function of neuromuscular junctions.
19135427 These findings suggest that USP14 is a novel player in the unfolded protein response by serving as a physiological inhibitor of ER-associated degradation under the non-stressed condition.
17553343 USP14 were over-expressed in ovarian serous cystadenocarcinoma tissues, suggesting that the activity of ubiquitin-proteasome system is obviously enhanced in ovarian cancer.
17079671 Neuronal expression of full-length USP14 is able to restore the levels of monomeric ubiquitin in the brains of transgenic ataxia mice.
16465409 Results show the overall survival rate was worse in patients with a high USP14/TGT60 kD expression level and suggest that USP14/TGT60 kD also controls the fate of proteins that regulate tumor invasion and metastasis.
16211010 the catalytic cleft leading to the active site of USP14 is blocked by two surface loops. Binding by ubiquitin induces a significant conformational change thereby allowing access of the ubiquitin C-terminus to the active site.

AA Sequence

MPLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGNIKIKNGMTLL      1 - 70
MMGSADALPEEPSAKTVFVEDMTEEQLASAMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGAL     71 - 140
RASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRV    141 - 210
LQQKLEAIEDDSVKETDSSSASAATPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFIN    211 - 280
QEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFP    281 - 350
LMLDMYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNTSDKKSSPQKEVKYEPFSFADDIGSNNCGYYDL    351 - 420
QAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEE    421 - 490
ESEQ                                                                      491 - 494
//

Text Mined References (43)

PMID Year Title
27074503 2016 USP14 deubiquitinates proteasome-bound substrates that are ubiquitinated at multiple sites.
26817839 2016 Post-endocytotic Deubiquitination and Degradation of the Metabotropic ?-Aminobutyric Acid Receptor by the Ubiquitin-specific Protease 14.
26712154 2016 Downregulation of ubiquitin-specific protease 14 (USP14) inhibits breast cancer cell proliferation and metastasis, but promotes apoptosis.
26523394 2015 Phosphorylation and activation of ubiquitin-specific protease-14 by Akt regulates the ubiquitin-proteasome system.
26397990 2015 USP14 activation promotes tumor progression in hepatocellular carcinoma.
25429837 2015 Ubiquitin-specific protease 14 (USP14) regulates cellular proliferation and apoptosis in epithelial ovarian cancer.
24556800 2014 MiR-4782-3p inhibited non-small cell lung cancer growth via USP14.
24319254 2014 A novel small molecule inhibitor of deubiquitylating enzyme USP14 and UCHL5 induces apoptosis in multiple myeloma and overcomes bortezomib resistance.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23958854 2013 Deubiquitination of Dishevelled by Usp14 is required for Wnt signaling.
23702845 2013 Over-expression of deubiquitinating enzyme USP14 in lung adenocarcinoma promotes proliferation through the accumulation of ?-catenin.
23615914 2013 Overexpression of USP14 protease reduces I-?B protein levels and increases cytokine release in lung epithelial cells.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23291607 Compensatory increase in USP14 activity accompanies impaired proteasomal proteolysis during aging.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21627382 2011 Ubiquitin-specific protease 14 expression associated with intrahepatic cholangiocarcinoma cell differentiation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19896943 2009 WITHDRAWN: USP14 stabilizes calcineurin and regulates NFAT/AP-1 dependent IL-4 transcription as a novel calcineurin-binding protein.
19726649 2009 The proteasome-associated deubiquitinating enzyme Usp14 is essential for the maintenance of synaptic ubiquitin levels and the development of neuromuscular junctions.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19367720 2008 Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.
19135427 2009 USP14 inhibits ER-associated degradation via interaction with IRE1alpha.
19106094 2009 Deubiquitination of CXCR4 by USP14 is critical for both CXCL12-induced CXCR4 degradation and chemotaxis but not ERK ativation.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18162577 2008 Relative structural and functional roles of multiple deubiquitylating proteins associated with mammalian 26S proteasome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17553343 2007 [Differential expression of USP2, USP14 and UBE4A between ovarian serous cystadenocarcinoma and adjacent normal tissues].
17079671 2006 Transgenic rescue of ataxia mice with neuronal-specific expression of ubiquitin-specific protease 14.
16465409 2006 Ubiquitin-specific protease 14 expression in colorectal cancer is associated with liver and lymph node metastases.
16211010 2005 Structure and mechanisms of the proteasome-associated deubiquitinating enzyme USP14.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14962675 2004 Inversion, duplication, and changes in gene context are associated with human chromosome 18 evolution.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14499622 2003 Yeast two-hybrid screens imply involvement of Fanconi anemia proteins in transcription regulation, cell signaling, oxidative metabolism, and cellular transport.
12838346 2003 Human and mouse proteases: a comparative genomic approach.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9827704 1998 Deubiquitinating enzymes: a new class of biological regulators.
8579355 1996 Cloning and characterization of cDNA encoding the rabbit tRNA-guanine transglycosylase 60-kilodalton subunit.