Property Summary

NCBI Gene PubMed Count 14
PubMed Score 13.19
PubTator Score 11.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
pre-eclampsia 67 3.219 1.6

Expression

Synonym

Accession Q96IX5 B2R4N2 D3DR92
Symbols DAPIT
HCVFTP2
bA792D24.4

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

PMID Text
26161955 DAPIT over-expression thus appears to modulate mitochondrial functions and alter cellular regulations, promote anaerobic metabolism and induce EMT-like transition.
22688299 confirm the mitochondrial presence of DAPIT on cellular level. We also show that DAPIT is localized in lysosomes of HUVEC and HEK 293T cells
21345788 a critical role of DAPIT in maintaining the ATP synthase population in mitochondria and raise an intriguing possibility of active role of DAPIT in cellular energy metabolism.

AA Sequence

MAGPESDAQYQFTGIKKYFNSYTLTGRMNCVLATYGSIALIVLYFKLRSKKTPAVKAT                  1 - 58
//

Text Mined References (17)

PMID Year Title
26161955 2015 DAPIT Over-Expression Modulates Glucose Metabolism and Cell Behaviour in HEK293T Cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22688299 2012 Cellular and tissue expression of DAPIT, a phylogenetically conserved peptide.
21345788 2011 Knockdown of DAPIT (diabetes-associated protein in insulin-sensitive tissue) results in loss of ATP synthase in mitochondria.
21269460 2011 Initial characterization of the human central proteome.
17575325 2007 Identification of two proteins associated with mammalian ATP synthase.
17570365 2007 Association of two proteolipids of unknown function with ATP synthase from bovine heart mitochondria.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16222733 2005 Study of transactivating effect of pre-S2 protein of hepatitis B virus and cloning of genes transactivated by pre-S2 protein with suppression subtractive hybridization.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.