Property Summary

NCBI Gene PubMed Count 64
PubMed Score 361.67
PubTator Score 175.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Gene RIF (37)

AA Sequence

MDMLDPGLDPAASATAAAAASHDKGPEAEEGVELQEGGDGPGAEEQTAVAITSVQQAAFGDHNIQYQFRT      1 - 70
ETNGGQVTYRVVQVTDGQLDGQGDTAGAVSVVSTAAFAGGQQAVTQVGVDGAAQRPGPAAASVPPGPAAP     71 - 140
FPLAVIQNPFSNGGSPAAEAVSGEARFAYFPASSVGDTTAVSVQTTDQSLQAGGQFYVMMTPQDVLQTGT    141 - 210
QRTIAPRTHPYSPKIDGTRTPRDERRRAQHNEVERRRRDKINNWIVQLSKIIPDCNADNSKTGASKGGIL    211 - 280
SKACDYIRELRQTNQRMQETFKEAERLQMDNELLRQQIEELKNENALLRAQLQQHNLEMVGEGTRQ        281 - 346
//

Text Mined References (64)

PMID Year Title