Property Summary

NCBI Gene PubMed Count 20
PubMed Score 21.06
PubTator Score 22.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
hepatocellular carcinoma 550 3.105 1.6

Expression

Gene RIF (14)

PMID Text
26429874 URG4 overexpression increased the resistance to cisplatin-induced apoptosis in bladder cancer.
25947641 This study suggests that URG4/URGCP plays an important pro-angiogenic role in HCC via a mechanism linked to activation of the NF-kappaB pathway
25835972 We presented first mechanisms of TMZ and URG4/URGCP relationship in neuroblastoma cells in this study. As a result, TMZ may be a novel candidate agent for treatment of neuroblastoma as a single or agent or together with other therapeutic agents
25427922 URG4 overexpression is correlated with cervical cancer progression and poor prognosis in patients with early-stage cervical cancer.
23821302 Data suggest that neuroblastoma (NB) cell differentiation might associate with peroxisome proliferator-activated receptor alpha (PPARalpha) and URG4/URGCP gene expression profile after retinoic acid (RA) treatment.
23053999 microRNA profiles were analyzedin HepG2 cells in presence or absence of URG4/URGCP gene using RNA interference.
23007575 Rapamycin diminishes URGCP gene expression in DU145 and PC3 cells, but increases expression in LNCaP cells.
22815774 The effects of URGCP/URG4-overexpression or -knockdown on expression of cell cycle regulators and transcriptional activity of FOXO3a, were examined.
22677619 higher expression of URG4 in our 2 patients suggests that URG4 might be involved in leukemogenesis
20714998 The data suggest that URG4 may play an important role in the development of hepatocellular carcinoma by partially regulating the expression of cyclin D1.
20491173 Expression of URG4 in hepatocellular carcinoma is closely related with the expression of HBx.
18972316 URG4 may play important roles in the development of osteosarcoma, and might be a useful molecular marker for predicting the prognosis of osteosarcoma.
17217616 URG4 plays an important role in the development of human gastric cancer by regulating the expression of cyclin D1.
12082552 URG4 may be a natural effector of HBxAg that contributes importantly to multistep hepatocarcinogenesis.

AA Sequence

MASPGIEVELLGKGHSDLGEVAPEIKASERRTAVAIADLEWREMEGDDCEFRYGDGTNEAQDNDFPTVER      1 - 70
SRLQEMLSLLGLETYQVQKLSLQDSLQISFDSMKNWAPQVPKDLPWNFLRKLQALNADARNTTMVLDVLP     71 - 140
DARPVEKESQMEEEIIYWDPADDLAADIYSFSELPTPDTPVNPLDLLCALLLSSDSFLQQEIALKMALCQ    141 - 210
FALPLVLPDSENHYHTFLLWAMRGIVRTWWSQPPRGMGSFREDSVVLSRAPAFAFVRMDVSSNSKSQLLN    211 - 280
AVLSPGHRQWDCFWHRDLNLGTNAREISDGLVEISWFFPSGREDLDIFPEPVAFLNLRGDIGSHWLQFKL    281 - 350
LTEISSAVFILTDNISKKEYKLLYSMKESTTKYYFILSPYRGKRNTNLRFLNKLIPVLKIDHSHVLVKVS    351 - 420
STDSDSFVKRIRAIVGNVLRAPCRRVSVEDMAHAARKLGLKVDEDCEECQKAKDRMERITRKIKDSDAYR    421 - 490
RDELRLQGDPWRKAAQVEKEFCQLQWAVDPPEKHRAELRRRLLELRMQQNGHDPSSGVQEFISGISSPSL    491 - 560
SEKQYFLRWMEWGLARVAQPRLRQPPETLLTLRPKHGGTTDVGEPLWPEPLGVEHFLREMGQFYEAESCL    561 - 630
VEAGRLPAGQRRFAHFPGLASELLLTGLPLELIDGSTLSMPVRWVTGLLKELHVRLERRSRLVVLSTVGV    631 - 700
PGTGKSTLLNTMFGLRFATGKSCGPRGAFMQLITVAEGFSQDLGCDHILVIDSGGLIGGALTSAGDRFEL    701 - 770
EASLATLLMGLSNVTVISLAETKDIPAAILHAFLRLEKTGHMPNYQFVYQNLHDVSVPGPRPRDKRQLLD    771 - 840
PPGDLSRAAAQMEKQGDGFRALAGLAFCDPEKQHIWHIPGLWHGAPPMAAVSLAYSEAIFELKRCLLENI    841 - 910
RNGLSNQNKNIQQLIELVRRL                                                     911 - 931
//

Text Mined References (25)

PMID Year Title
26429874 2015 URGCP/URG4 promotes apoptotic resistance in bladder cancer cells by activating NF-?B signaling.
25947641 2015 URG4/URGCP enhances the angiogenic capacity of human hepatocellular carcinoma cells in vitro via activation of the NF-?B signaling pathway.
25835972 2015 Temozolomide may induce cell cycle arrest by interacting with URG4/URGCP in SH-SY5Y neuroblastoma cells.
25427922 2014 URG4 overexpression is correlated with cervical cancer progression and poor prognosis in patients with early-stage cervical cancer.
23821302 2013 Regulation of URG4/URGCP and PPAR? gene expressions after retinoic acid treatment in neuroblastoma cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23053999 2012 Investigation of microRNA expression changes in HepG2 cell line in presence of URG4/URGCP and in absence of URG4/URGCP suppressed by RNA interference.
23007575 2012 The expression of URGCP gene in prostate cancer cell lines: correlation with rapamycin.
22815774 2012 Upregulator of cell proliferation predicts poor prognosis in hepatocellular carcinoma and contributes to hepatocarcinogenesis by downregulating FOXO3a.
22677619 2012 Higher expression of the novel gene upregulated gene 4 in two acute lymphoblastic leukemia patients with poor prednisolone response.
20714998 2010 RNA interference-mediated URG4 gene silencing diminishes cyclin D1 mRNA expression in HepG2 cells.
20491173 2010 [Expression of URG4 in hepatocellular carcinoma and its correlation with HBx].
18972316 2009 The expression of novel gene URG4 in osteosarcoma: correlation with patients' prognosis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17217616 2006 Enhanced cell survival of gastric cancer cells by a novel gene URG4.
16730941 2006 A systematic analysis of human CHMP protein interactions: additional MIT domain-containing proteins bind to multiple components of the human ESCRT III complex.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15203218 2004 Circular rapid amplification of cDNA ends for high-throughput extension cloning of partial genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12082552 Hepatitis Bx antigen stimulates expression of a novel cellular gene, URG4, that promotes hepatocellular growth and survival.
10819331 2000 Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.