Property Summary

NCBI Gene PubMed Count 2
PubMed Score 7.00
PubTator Score 2.50

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MDIEKVNSMDLGEFVDVFGNATERCPLIAAAVWSQRPFSDLEDLEKHFFAFIDALAQSGQEGILRCHPDL      1 - 70
AGSELQRGTLTAESQREQSGAGLRSLGADERLRLAELNAQYRARFGFPFVLAARFSDRTAVPRELARRLL     71 - 140
CPSAQELRTALGEVKKIGSLRLADLLRADPAKL                                         141 - 173
//

Text Mined References (3)

PMID Year Title