Property Summary

NCBI Gene PubMed Count 10
PubMed Score 10.97
PubTator Score 6.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 1.400 1.2e-04
Multiple myeloma 1.302 8.1e-04
ovarian cancer 1.900 4.5e-05

Gene RIF (4)

AA Sequence

MGREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERS      1 - 70
KRKNPAAYENDK                                                               71 - 82
//

Text Mined References (12)

PMID Year Title