Property Summary

NCBI Gene PubMed Count 1
PubMed Score 9.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
Breast cancer 3098 2.7e-06

Expression

  Differential Expression (1)

Disease log2 FC p
Breast cancer 1.400 2.7e-06

AA Sequence

MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELYDEHVSSRSHTEEDCTEE      1 - 70
LFDFLHAKDHCVAHKLFNNLK                                                      71 - 91
//

Text Mined References (2)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
11181995 2001 The sequence of the human genome.