Property Summary

NCBI Gene PubMed Count 11
PubMed Score 9.64
PubTator Score 8.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Gene RIF (3)

PMID Text
22082156 Knockdown of ubiquinol-cytochrome c reductase hinge protein (UQCRH) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
20877624 Observational study of gene-disease association. (HuGE Navigator)
12881716 These data provide preliminary evidence of the inactivation of UQCRH gene in cancer either by structural rearrangements or epigenetic mechanisms.

AA Sequence

MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEE      1 - 70
LFDFLHARDHCVAHKLFNNLK                                                      71 - 91
//

Text Mined References (15)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20833797 2011 Phosphoproteome analysis of functional mitochondria isolated from resting human muscle reveals extensive phosphorylation of inner membrane protein complexes and enzymes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12881716 2003 UQCRH gene encoding mitochondrial Hinge protein is interrupted by a translocation in a soft-tissue sarcoma and epigenetically inactivated in some cancer cell lines.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
7821789 1994 Construction of a human full-length cDNA bank.
7684318 1993 Elevated expression of the human mitochondrial hinge protein gene in cancer.
2826252 1987 An extremely acidic amino-terminal presequence of the precursor for the human mitochondrial hinge protein.