Property Summary

NCBI Gene PubMed Count 22
PubMed Score 20.81
PubTator Score 18.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.260 3.4e-03
Multiple myeloma 1.616 1.1e-04
psoriasis -1.500 7.2e-05
glioblastoma -1.900 1.5e-03
osteosarcoma -1.119 4.7e-05
ependymoma -1.400 1.4e-06
medulloblastoma -1.600 7.1e-04
astrocytoma -1.400 8.4e-03
atypical teratoid / rhabdoid tumor -2.900 4.4e-08
medulloblastoma, large-cell -1.900 7.9e-04
Breast cancer 2.300 3.1e-02
adult high grade glioma -1.900 4.0e-04
Pneumonia -2.400 1.6e-03
subependymal giant cell astrocytoma -2.310 2.7e-02
Polycystic Ovary Syndrome 1.416 3.3e-03
lung carcinoma 1.200 3.0e-21

Gene RIF (6)

PMID Text
25446085 a UQCRB mutation promotes angiogenesis through the generation of mitochondrial reactive oxygen species
23708980 Mitochondrial UQCRB regulates VEGFR2 signaling in endothelial cells.
23475074 Studies indicate that mitochondrial oxygen sensor ubiquinol-cytochrome c reductase binding protein (UQCRB) as a terpestacin-binding protein.
22545919 Two SNPs in the 3' untranslated region of UQCRB (complex III), rs7836698 and rs10504961, were associated with overall survival.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19064571 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAGKQAVSASGKWLDGIRKWYYNAAGFNKLGLMRDDTIYEDEDVKEAIRRLPENLYNDRMFRIKRALDLN      1 - 70
LKHQILPKEQWTKYEEENFYLEPYLKEVIRERKEREEWAKK                                  71 - 111
//

Text Mined References (26)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25446085 2014 A mutation in the mitochondrial protein UQCRB promotes angiogenesis through the generation of mitochondrial reactive oxygen species.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23708980 2013 Mitochondrial UQCRB regulates VEGFR2 signaling in endothelial cells.
23475074 2013 Exploring the role of mitochondrial UQCRB in angiogenesis using small molecules.
22545919 2012 Polymorphisms in the mitochondrial oxidative phosphorylation chain genes as prognostic markers for colorectal cancer.
21269460 2011 Initial characterization of the human central proteome.
21215626 2011 Identification of a novel small molecule targeting UQCRB of mitochondrial complex III and its anti-angiogenic activity.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20803152 2011 Responses of muscle mass, strength and gene transcripts to long-term heat stress in healthy human subjects.
19549744 2009 Thyroid hormone-related regulation of gene expression in human fatty liver.
19077451 2009 Genome-wide analysis of pancreatic cancer using microarray-based techniques.
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
18445752 2008 Molecular correlates for maximal oxygen uptake and type 1 fibers.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12709789 2003 A deletion in the human QP-C gene causes a complex III deficiency resulting in hypoglycaemia and lactic acidosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8751380 1996 Localization of the human gene encoding the 13.3-kDa subunit of mitochondrial complex III (UQCRB) to 8q22 by in situ hybridization.
3056408 1988 Cloning and sequencing of a cDNA for human mitochondrial ubiquinone-binding protein of complex III.
2981208 1985 Complete amino acid sequence of the ubiquinone binding protein (QP-C), a protein similar to the 14,000-dalton subunit of the yeast ubiquinol-cytochrome c reductase complex.
2543413 1989 Isolation of a single nuclear gene encoding human ubiquinone-binding protein in complex III of mitochondrial respiratory chain.
2167087 1990 Chromosomal assignment of the gene for the ubiquinone-binding protein of human mitochondrial cytochrome bc1 complex.
2159470 1990 Common protein-binding sites in the 5'-flanking regions of human genes for cytochrome c1 and ubiquinone-binding protein.