Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.54
PubTator Score 2.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Precancerous Conditions 80 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 1.1e-04
Multiple myeloma 1332 6.4e-04

Expression

  Differential Expression (2)

Disease log2 FC p
Multiple myeloma 1.534 6.4e-04
ovarian cancer -1.400 1.1e-04

Gene RIF (1)

AA Sequence

MVTRFLGPRYRELVKNWVPTAYTWGAVGAVGLVWATDWRLILDWVPYINGKFKKDN                    1 - 56
//

Text Mined References (7)

PMID Year Title