Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.35
PubTator Score 2.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
Precancerous Conditions 69
Disease Target Count P-value
ovarian cancer 8491 1.1e-04
Multiple myeloma 1327 6.4e-04

Expression

  Differential Expression (2)

Disease log2 FC p
Multiple myeloma 1.534 6.4e-04
ovarian cancer -1.400 1.1e-04

Protein-protein Interaction (5)

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MVTRFLGPRYRELVKNWVPTAYTWGAVGAVGLVWATDWRLILDWVPYINGKFKKDN                    1 - 56
//

Text Mined References (7)

PMID Year Title
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10453733 1999 A mitochondrial cytochrome b mutation but no mutations of nuclearly encoded subunits in ubiquinol cytochrome c reductase (complex III) deficiency.
9161705 1997 Primary structure of the smallest (6.4-kDa) subunit of human and bovine ubiquinol-cytochrome c reductase deduced from cDNA sequences.