Property Summary

NCBI Gene PubMed Count 33
PubMed Score 20.20
PubTator Score 15.98

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis 1.700 1.9e-04
osteosarcoma -1.201 2.2e-03
atypical teratoid / rhabdoid tumor 1.100 1.9e-04
intraductal papillary-mucinous carcinoma... 1.100 7.8e-04
intraductal papillary-mucinous neoplasm ... 2.000 4.1e-04
Pick disease -1.100 5.7e-07

Gene RIF (17)

PMID Text
25848760 Single nucleotide polymorphism in UQCC is associated with developmental dysplasia of the hip.
25008109 UQCC3 is reduced in cells depleted for the complex III assembly factors UQCC1 and UQCC2. Conversely, absence of UQCC3 in patient cells does not affect UQCC1 and UQCC2.
24385928 This work provides insight into human complex III assembly by establishing that UQCC1 and UQCC2 are complex III assembly factors participating in cytochrome b biogenesis.
23207799 study identified a novel locus, i.e., the UQCC gene, for spine BS variation in humans. Future functional studies will contribute to elucidating the mechanisms by which UQCC regulates bone growth and development
21224470 These data suggest that HLX may function to balance attractive with repulsive vessel guidance by up-regulating UNC5B and to down-modulate sprouting under normoxic conditions.
21208810 Data show that high serum VEGF levels are closely related to the activation status of the VEGFR2/KDR receptor in cancer cells, indicating a stimulatory effect of serum VEGF on the VEGF pathway contributing to tumor progression.
21110828 Current and potential anticancer drugs targeting members of the UHRF1 complex including epigenetic modifiers.
21077742 High VEGF is associated with peripheral T-cell lymphoma.
21043486 Ca2+ homeostasis modulation enhances the amenability of L444P glucosylcerebrosidase to proteostasis regulation in patient-derived fibroblasts.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20546612 Observational study of gene-disease association. (HuGE Navigator)
20444731 GPC3 was significantly more often and more strongly expressed in HCCs (72%) than in FLCs (17%).
20072657 Data show that a significant increase in plasma SDF-1alpha, and an immediate decrease in plasma VEGF and FGF levels after chemotherapy.
19863319 The majority of tumours showed strong p16, p21, p27, pRb and cyclin D1 staining and little or no p53 expression. Tumours harbouring dysplasia were significantly more likely to be p53-positive and exhibit up-regulated p21 and p27
19343178 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19266077 Observational study of gene-disease association. (HuGE Navigator)
11118897 This paper describes the cloning of the human UQCC gene.

AA Sequence

MALLVRVLRNQTSISQWVPVCSRLIPVSPTQGQGDRALSRTSQWPQMSQSRACGGSEQIPGIDIQLNRKY      1 - 70
HTTRKLSTTKDSPQPVEEKVGAFTKIIEAMGFTGPLKYSKWKIKIAALRMYTSCVEKTDFEEFFLRCQMP     71 - 140
DTFNSWFLITLLHVWMCLVRMKQEGRSGKYMCRIIVHFMWEDVQQRGRVMGVNPYILKKNMILMTNHFYA    141 - 210
AILGYDEGILSDDHGLAAALWRTFFNRKCEDPRHLELLVEYVRKQIQYLDSMNGEDLLLTGEVSWRPLVE    211 - 280
KNPQSILKPHSPTYNDEGL                                                       281 - 299
//

Text Mined References (36)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25848760 2015 A common variant of ubiquinol-cytochrome c reductase complex is associated with DDH.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25008109 2014 A mutation in the human CBP4 ortholog UQCC3 impairs complex III assembly, activity and cytochrome b stability.
24385928 2013 Mutations in the UQCC1-interacting protein, UQCC2, cause human complex III deficiency associated with perturbed cytochrome b protein expression.
23509962 2013 A genome-wide search for common SNP x SNP interactions on the risk of venous thrombosis.
23207799 2013 Genome-wide association study identified UQCC locus for spine bone size in humans.
21269460 2011 Initial characterization of the human central proteome.
21224470 2011 The VEGF-regulated transcription factor HLX controls the expression of guidance cues and negatively regulates sprouting of endothelial cells.
21208810 2011 Serum VEGF levels and tissue activation of VEGFR2/KDR receptors in patients with breast and gynecologic cancer.
21110828 2011 Current and potential anticancer drugs targeting members of the UHRF1 complex including epigenetic modifiers.
21077742 2011 Expression of tumor-associated macrophages and vascular endothelial growth factor correlates with poor prognosis of peripheral T-cell lymphoma, not otherwise specified.
21043486 2011 Ca2+ homeostasis modulation enhances the amenability of L444P glucosylcerebrosidase to proteostasis regulation in patient-derived fibroblasts.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
20444731 2010 Fibrolamellar hepatocellular carcinoma: an immunohistochemical comparison with conventional hepatocellular carcinoma.
20189936 2010 A genome-wide association study in 19 633 Japanese subjects identified LHX3-QSOX2 and IGF1 as adult height loci.
20072657 2010 Late release of circulating endothelial cells and endothelial progenitor cells after chemotherapy predicts response and survival in cancer patients.
19863319 2009 Expression of p53, p16INK4A, pRb, p21WAF1/CIP1, p27KIP1, cyclin D1, Ki-67 and HPV DNA in sinonasal endophytic Schneiderian (inverted) papilloma.
19343178 2009 Meta-analysis of genome-wide scans for human adult stature identifies novel Loci and associations with measures of skeletal frame size.
19266077 2009 Genetic determinants of height growth assessed longitudinally from infancy to adulthood in the northern Finland birth cohort 1966.
18391952 2008 Genome-wide association analysis identifies 20 loci that influence adult height.
18391951 2008 Many sequence variants affecting diversity of adult human height.
18391950 2008 Identification of ten loci associated with height highlights new biological pathways in human growth.
18193045 2008 Common variants in the GDF5-UQCC region are associated with variation in human height.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12878157 2003 Redifferentiation of dedifferentiated chondrocytes and chondrogenesis of human bone marrow stromal cells via chondrosphere formation with expression profiling by large-scale cDNA analysis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11118897 2001 Expression of a novel mouse gene 'mbFZb' in distinct regions of the developing nervous system and the adult brain.
11076863 2000 DNA cloning using in vitro site-specific recombination.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.