Property Summary

NCBI Gene PubMed Count 14
PubMed Score 4.44
PubTator Score 5.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.200 1.9e-03
atypical teratoid / rhabdoid tumor -1.700 7.0e-11
ependymoma -1.200 1.6e-06
glioblastoma -1.400 5.5e-09
medulloblastoma -1.200 1.5e-05
medulloblastoma, large-cell -1.800 1.3e-05
oligodendroglioma -1.100 1.0e-02
pancreatic ductal adenocarcinoma liver m... -1.676 6.1e-04
primitive neuroectodermal tumor -1.900 1.6e-06

Gene RIF (4)

AA Sequence

MASVIPASNRSMRSDRNTYVGKRFVHVKNPYLDLMDEDILYHLDLGTKTHNLPAMFGDVKFVCVGGSPNR      1 - 70
MKAFALFMHKELGFEEAEEDIKDICAGTDRYCMYKTGPVLAISHGMGIPSISIMLHELIKLLHHARCCDV     71 - 140
TIIRIGTSGGIGIAPGTVVITDIAVDSFFKPRFEQVILDNIVTRSTELDKELSEELFNCSKEIPNFPTLV    141 - 210
GHTMCTYDFYEGQGRLDGALCSFSREKKLDYLKRAFKAGVRNIEMESTVFAAMCGLCGLKAAVVCVTLLD    211 - 280
RLDCDQINLPHDVLVEYQQRPQLLISNFIRRRLGLCD                                     281 - 317
//

Text Mined References (14)

PMID Year Title