Property Summary

NCBI Gene PubMed Count 10
PubMed Score 61.21
PubTator Score 51.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma 1.400 5.0e-06
oligodendroglioma -1.200 3.9e-02
psoriasis 3.000 8.4e-199
cutaneous lupus erythematosus 1.200 3.7e-03
glioblastoma 2.000 2.0e-03
osteosarcoma -1.990 8.2e-04
group 4 medulloblastoma -1.500 1.1e-04
medulloblastoma, large-cell -2.300 8.0e-06
tuberculosis and treatment for 3 months -1.300 2.2e-04
lung cancer -2.200 3.3e-04
cystic fibrosis 1.400 7.9e-05
posterior fossa group B ependymoma -1.100 6.1e-03
lung carcinoma -1.300 5.7e-13
gastric carcinoma 2.300 1.9e-02
mucosa-associated lymphoid tissue lympho... 1.151 1.3e-02
ovarian cancer 1.400 2.4e-03

Synonym

Accession Q16831 D3DVM4 Q15362 UPase 1
Symbols UP
UPP
UPASE
UDRPASE

Gene

PANTHER Protein Class (2)

PDB

3EUE   3EUF   3NBQ  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (2)

Gene RIF (8)

PMID Text
22632162 HIV-1 Tat 47-59 peptide downregulates gene expression of uridine phosphorylase 1 (UPP1) in U-937 macrophages
20856879 The dimeric enzyme is capable of a large hinge motion facilitating ligand exchange.
19714313 Data show that enhanced cytotoxicity of 5-FU by bFGF through modulating the expression of UPP1 at the transcription level.
19291308 The presented structures confirm that hUPP1 is dimeric. They also reveal the mechanism by which 5-benzylacyclouridine engages the active site of the protein and disables the enzyme by locking the protein in a closed conformation.
16798057 Thymidine phosphorylase and uridine phosphorylase were both responsible for converting 5'dFUrd/5FU into 5FU/FUrd, respectively
12115385 Uridine phosphorylase overexpression is associated with lymph node metastasis in oral neoplasms
12084455 Characterization of the promoter region of UPase has indicated a direct regulation of its expression by the tumor suppressor gene p53. Review.
11807789 The expression level of UPase gene may be an independent prognostic marker in human breast carcinoma

AA Sequence

MAATGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFPALFGDVKFVCVGGSPSRMKAFIR      1 - 70
CVGAELGLDCPGRDYPNICAGTDRYAMYKVGPVLSVSHGMGIPSISIMLHELIKLLYYARCSNVTIIRIG     71 - 140
TSGGIGLEPGTVVITEQAVDTCFKAEFEQIVLGKRVIRKTDLNKKLVQELLLCSAELSEFTTVVGNTMCT    141 - 210
LDFYEGQGRLDGALCSYTEKDKQAYLEAAYAAGVRNIEMESSVFAAMCSACGLQAAVVCVTLLNRLEGDQ    211 - 280
ISSPRNVLSEYQQRPQRLVSYFIKKKLSKA                                            281 - 310
//

Text Mined References (11)

PMID Year Title
21269460 2011 Initial characterization of the human central proteome.
20856879 2010 Active site conformational dynamics in human uridine phosphorylase 1.
19714313 2009 Enhanced cytotoxicity of 5-FU by bFGF through up-regulation of uridine phosphorylase 1.
19291308 2009 Implications of the structure of human uridine phosphorylase 1 on the development of novel inhibitors for improving the therapeutic window of fluoropyrimidine chemotherapy.
16798057 2006 The role of thymidine phosphorylase and uridine phosphorylase in (fluoro)pyrimidine metabolism in peripheral blood mononuclear cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11278417 2001 Uridine phosphorylase association with vimentin. Intracellular distribution and localization.
7488099 1995 Cloning and expression of human uridine phosphorylase.
752472 1978 Assignment of a gene for uridine phosphorylase to chromosome 7.