Property Summary

NCBI Gene PubMed Count 27
PubMed Score 78.55
PubTator Score 57.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
urothelial carcinoma -3.300 3.2e-03
interstitial cystitis -5.700 3.6e-06

Gene RIF (14)

PMID Text
25743828 High expression level of preoperative serum Uroplakin III is associated with biologically aggressive bladder cancer.
25368291 High Uroplakin III expression is associated with bladder urothelial carcinoma from malignancy metastatic to the urinary bladder.
24553301 a strong association between UPIII and in the group with tumor recurrence
22632162 FITC-labeled Tat 47-59 peptide downregulates gene expression of uroplakin 3A (UPK3A) in U-937 macrophages
19959718 Observational study of gene-disease association. (HuGE Navigator)
19412341 studies suggest that bacteria-induced UPIIIa signaling is a critical mediator of bladder responses to insult by uropathogenic E. coli
19007907 Uroplakin III plays a pivotal role in Eshcerichia coli UTI pathogenesis.
18528285 Not a useful immunohistochemical marker for detection of pleural malignant mesothelioma.
18313120 Loss of UP III expression is associated with established markers of biologically aggressive bladder cancer
17880289 Uroplakin III mRNA is up-regulated to a greater extent in vesicoureteral reflux than in control exfoliated urinary cells.
17698128 uroplakin III and III-delta4 genes were significantly up-regulated only in patients with nonulcerative interstitial cystitis
16731295 Our results indicate that de novo mutations in UPIIIA can be involved in defective early kidney development, but probably constitute only a rare cause of human renal hypodysplasia in a minor subset of individuals [UPIIIA].
14713856 Observational study of gene-disease association. (HuGE Navigator)
14654529 Loss of p63 expression is a prerequisite for uroplakin III expression in urothelial bladder cancer.

AA Sequence

MPPLWALLALGCLRFGSAVNLQPQLASVTFATNNPTLTTVALEKPLCMFDSKEALTGTHEVYLYVLVDSA      1 - 70
ISRNASVQDSTNTPLGSTFLQTEGGRTGPYKAVAFDLIPCSDLPSLDAIGDVSKASQILNAYLVRVGANG     71 - 140
TCLWDPNFQGLCNAPLSAATEYRFKYVLVNMSTGLVEDQTLWSDPIRTNQLTPYSTIDTWPGRRSGGMIV    141 - 210
ITSILGSLPFFLLVGFAGAIALSLVDMGSSDGETTHDSQITQEAVPKSLGASESSYTSVNRGPPLDRAEV    211 - 280
YSSKLQD                                                                   281 - 287
//

Text Mined References (29)

PMID Year Title
25743828 2015 High expression level of preoperative serum Uroplakin III is associated with biologically aggressive bladder cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25368291 2014 Value of uroplakin III in distinguishing variants of primary bladder urothelial carcinoma from malignancy metastatic to the urinary bladder.
24553301 2014 Significance of uroplakin III expression in recurrence of solitary muscle non-invasive bladder cancer.
23541324 2013 Genome-wide association study identifies TH1 pathway genes associated with lung function in asthmatic patients.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
19959718 2010 Whole-genome linkage and association scan in primary, nonsyndromic vesicoureteric reflux.
19412341 2009 Bacteria-induced uroplakin signaling mediates bladder response to infection.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19007907 2009 Differentiation-induced uroplakin III expression promotes urothelial cell death in response to uropathogenic E. coli.
18528285 2008 Uroplakin is not a reliable immunohistochemical marker for malignant mesothelioma of the pleura.
18313120 2008 Loss expression of uroplakin III is associated with clinicopathologic features of aggressive bladder cancer.
17880289 2007 Up-regulation of urinary UPIII mRNA levels in vesicoureteral reflux patients: potential application as a screening test for vesicoureteral reflux.
17698128 2007 Uroplakin III-delta4 messenger RNA as a promising marker to identify nonulcerative interstitial cystitis.
16731295 2006 Mutations in Uroplakin IIIA are a rare cause of renal hypodysplasia in humans.
15888565 2005 De novo Uroplakin IIIa heterozygous mutations cause human renal adysplasia leading to severe kidney failure.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
14713856 2004 No pathogenic mutations in the uroplakin III gene of 25 patients with primary vesicoureteral reflux.
14654529 2003 Impaired p63 expression associates with poor prognosis and uroplakin III expression in invasive urothelial carcinoma of the bladder.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475947 2002 Specific heterodimer formation is a prerequisite for uroplakins to exit from the endoplasmic reticulum.
12474225 2003 Uroplakin gene expression in normal human tissues and locally advanced bladder cancer.
10591208 1999 The DNA sequence of human chromosome 22.
10514386 1999 Immunohistochemical analysis of uroplakins, urothelial specific proteins, in ovarian Brenner tumors, normal tissues, and benign and neoplastic lesions of the female genital tract.
9846985 1998 Uroplakin gene expression by normal and neoplastic human urothelium.
9818021 1998 Expression of uroplakin Ib and uroplakin III genes in tissues and peripheral blood of patients with transitional cell carcinoma.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.