Property Summary

NCBI Gene PubMed Count 19
PubMed Score 21.52
PubTator Score 31.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma -3.100 1.2e-08
psoriasis -2.100 7.2e-60
cystic fibrosis 3.000 1.8e-05
medulloblastoma, large-cell 1.400 1.2e-04
non-small cell lung cancer 2.529 1.6e-06
intraductal papillary-mucinous neoplasm ... 3.900 5.3e-04
interstitial cystitis -4.900 2.4e-04
nasopharyngeal carcinoma -4.300 1.2e-08
ovarian cancer -2.400 3.3e-03
head and neck cancer and chronic obstruc... -1.300 2.0e-02

Gene RIF (5)

PMID Text
24559587 Urine UPIb levels may be useful for predicting the risk of recurrent urinary tract infections in patients diagnosed with their first UTI and may also be considered as a noninvasive screening test for vesicoureteral reflux.
18355812 The biopsy-induced increase in the expression of UPIb and other genes encoding membrane proteins supports the possible importance of the membrane structure and stability during implantation.
16354592 Loss of uroplakin Ib expression by CpG methylation of Sp1/NFkappaB-binding motifs within the proximal promoter is associated with urothelial tumors
15140401 Loss of uroplakin Ib expression is associated with bladder carcinomas
12031497 established the genomic organization of the UPIb gene

AA Sequence

MAKDNSTVRCFQGLLIFGNVIIGCCGIALTAECIFFVSDQHSLYPLLEATDNDDIYGAAWIGIFVGICLF      1 - 70
CLSVLGIVGIMKSSRKILLAYFILMFIVYAFEVASCITAATQQDFFTPNLFLKQMLERYQNNSPPNNDDQ     71 - 140
WKNNGVTKTWDRLMLQDNCCGVNGPSDWQKYTSAFRTENNDADYPWPRQCCVMNNLKEPLNLEACKLGVP    141 - 210
GFYHNQGCYELISGPMNRHAWGVAWFGFAILCWTFWVLLGTMFYWSRIEY                        211 - 260
//

Text Mined References (20)

PMID Year Title
24559587 2014 The predictive value of urinary UPIb mRNA levels in VUR and recurrent urinary tract infections.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18355812 2009 Endometrial biopsy-induced gene modulation: first evidence for the expression of bladder-transmembranal uroplakin Ib in human endometrium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16354592 2005 Uroplakin Ib gene transcription in urothelial tumor cells is regulated by CpG methylation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15140401 Methylation of a CpG island within the uroplakin Ib promoter: a possible mechanism for loss of uroplakin Ib expression in bladder carcinoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475947 2002 Specific heterodimer formation is a prerequisite for uroplakins to exit from the endoplasmic reticulum.
12031497 2002 Human uroplakin lb gene structure and promoter analysis.
11739647 2001 Complexes of tetraspanins with integrins: more than meets the eye.
10514386 1999 Immunohistochemical analysis of uroplakins, urothelial specific proteins, in ovarian Brenner tumors, normal tissues, and benign and neoplastic lesions of the female genital tract.
9935153 1999 Cloning of the human uroplakin 1B cDNA and analysis of its expression in urothelial-tumor cell lines and bladder-carcinoma tissue.
9846985 1998 Uroplakin gene expression by normal and neoplastic human urothelium.
9818021 1998 Expression of uroplakin Ib and uroplakin III genes in tissues and peripheral blood of patients with transitional cell carcinoma.
9073521 1997 Chromosomal localization of the human urothelial "tetraspan" gene, UPK1B, to 3q13.3-q21 and detection of a TaqI polymorphism.
8530366 1995 Selective interactions of UPIa and UPIb, two members of the transmembrane 4 superfamily, with distinct single transmembrane-domained proteins in differentiated urothelial cells.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.