Property Summary

NCBI Gene PubMed Count 49
PubMed Score 23.19
PubTator Score 25.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
adrenocortical carcinoma 1.260 8.4e-04
dermatomyositis 1.400 1.0e-04
lung cancer 1.600 1.7e-04
malignant mesothelioma 1.500 4.3e-07
Pick disease -1.100 9.4e-04
progressive supranuclear palsy -1.200 8.3e-03

Protein-protein Interaction (2)

Gene RIF (20)

AA Sequence

MKEEKEHRPKEKRVTLLTPAGATGSGGGTSGDSSKGEDKQDRNKEKKEALSKVVIRRLPPTLTKEQLQEH      1 - 70
LQPMPEHDYFEFFSNDTSLYPHMYARAYINFKNQEDIILFRDRFDGYVFLDNKGQEYPAIVEFAPFQKAA     71 - 140
KKKTKKRDTKVGTIDDDPEYRKFLESYATDNEKMTSTPETLLEEIEAKNRELIAKKTTPLLSFLKNKQRM    141 - 210
REEKREERRRREIERKRQREEERRKWKEEEKRKRKDIEKLKKIDRIPERDKLKDEPKIKVHRFLLQAVNQ    211 - 280
KNLLKKPEKGDEKELDKREKAKKLDKENLSDERASGQSCTLPKRSDSELKDEKPKRPEDESGRDYRERER    281 - 350
EYERDQERILRERERLKRQEEERRRQKERYEKEKTFKRKEEEMKKEKDTLRDKGKKAESTESIGSSEKTE    351 - 420
KKEEVVKRDRIRNKDRPAMQLYQPGARSRNRLCPPDDSTKSGDSAAERKQESGISHRKEGGEE           421 - 483
//

Text Mined References (57)

PMID Year Title