Property Summary

NCBI Gene PubMed Count 21
PubMed Score 36.78
PubTator Score 20.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 2.7e-06
psoriasis 6694 2.9e-04
Disease Target Count Z-score Confidence
Atypical autism 26 4.104 2.1
Intellectual disability 1016 3.17 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.469 2.7e-06
psoriasis -2.400 2.9e-04

Protein-protein Interaction (13)

Gene RIF (5)

AA Sequence

MRSEKEGAGGLRAAVAARGPSGREKLSALEVQFHRDSQQQEAETPPTSSSGCGGGAGKPREEKRTALSKV      1 - 70
VIRRLPPGLTKEQLEEQLRPLPAHDYFEFFAADLSLYPHLYSRAYINFRNPDDILLFRDRFDGYIFLDSK     71 - 140
GLEYPAVVEFAPFQKIAKKKLRKKDAKTGSIEDDPEYKKFLETYCVEEEKTSANPETLLGEMEAKTRELI    141 - 210
ARRTTPLLEYIKNRKLEKQRIREEKREERRRRELEKKRLREEEKRRRREEERCKKKETDKQKKIAEKEVR    211 - 280
IKLLKKPEKGEEPTTEKPKERGEEIDTGGGKQESCAPGAVVKARPMEGSLEEPQETSHSGSDKEHRDVER    281 - 350
SQEQESEAQRYHVDDGRRHRAHHEPERLSRRSEDEQRWGKGPGQDRGKKGSQDSGAPGEAMERLGRAQRC    351 - 420
DDSPAPRKERLANKDRPALQLYDPGARFRARECGGNRRICKAEGSGTGPEKREEAE                  421 - 476
//

Text Mined References (22)

PMID Year Title