Property Summary

NCBI Gene PubMed Count 20
PubMed Score 33.98
PubTator Score 20.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 2.7e-06
psoriasis 6685 2.9e-04
Disease Target Count Z-score Confidence
Atypical autism 25 4.23 2.1

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis -2.400 2.9e-04
osteosarcoma -1.469 2.7e-06

Gene RIF (5)

PMID Text
19503078 Results suggest that UPF3A levels are tightly regulated by a post-transcriptional switch to maintain appropriate levels of NMD substrates in cells containing different levels of UPF3B.
17803942 The Upf complex communicates with the exon-junction complex and triggers nonsense-mediated decay in the cytoplasm.
16601204 hUpf3a is much less active than hUpf3b to induce NMD and to stimulate translation
15004547 The complex between the interacting domains of human UPF2 and UPF3b at a 1.95 A resolution.
11546873 binds to spliced mRNAs upstream of exon-exon junctions; is part of mRNP complexes that are ready for nuclear export and that participate in nonsense-mediated mRNA decay

AA Sequence

MRSEKEGAGGLRAAVAARGPSGREKLSALEVQFHRDSQQQEAETPPTSSSGCGGGAGKPREEKRTALSKV      1 - 70
VIRRLPPGLTKEQLEEQLRPLPAHDYFEFFAADLSLYPHLYSRAYINFRNPDDILLFRDRFDGYIFLDSK     71 - 140
GLEYPAVVEFAPFQKIAKKKLRKKDAKTGSIEDDPEYKKFLETYCVEEEKTSANPETLLGEMEAKTRELI    141 - 210
ARRTTPLLEYIKNRKLEKQRIREEKREERRRRELEKKRLREEEKRRRREEERCKKKETDKQKKIAEKEVR    211 - 280
IKLLKKPEKGEEPTTEKPKERGEEIDTGGGKQESCAPGAVVKARPMEGSLEEPQETSHSGSDKEHRDVER    281 - 350
SQEQESEAQRYHVDDGRRHRAHHEPERLSRRSEDEQRWGKGPGQDRGKKGSQDSGAPGEAMERLGRAQRC    351 - 420
DDSPAPRKERLANKDRPALQLYDPGARFRARECGGNRRICKAEGSGTGPEKREEAE                  421 - 476
//

Text Mined References (21)

PMID Year Title
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
19503078 2009 A UPF3-mediated regulatory switch that maintains RNA surveillance.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17916692 2007 Telomeric repeat containing RNA and RNA surveillance factors at mammalian chromosome ends.
17803942 2007 Communication with the exon-junction complex and activation of nonsense-mediated decay by human Upf proteins occur in the cytoplasm.
17704778 2007 Mutations in UPF3B, a member of the nonsense-mediated mRNA decay complex, cause syndromic and nonsyndromic mental retardation.
16601204 2006 Functions of hUpf3a and hUpf3b in nonsense-mediated mRNA decay and translation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231747 2004 A protein interaction framework for human mRNA degradation.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
15004547 2004 The structural basis for the interaction between nonsense-mediated mRNA decay factors UPF2 and UPF3.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14636577 2003 Phosphorylation of hUPF1 induces formation of mRNA surveillance complexes containing hSMG-5 and hSMG-7.
12554878 2003 Characterization of human Smg5/7a: a protein with similarities to Caenorhabditis elegans SMG5 and SMG7 that functions in the dephosphorylation of Upf1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12417715 2002 Identification of a human decapping complex associated with hUpf proteins in nonsense-mediated decay.
11546874 2001 Communication of the position of exon-exon junctions to the mRNA surveillance machinery by the protein RNPS1.
11546873 2001 Role of the nonsense-mediated decay factor hUpf3 in the splicing-dependent exon-exon junction complex.
11544179 2001 Human SMG-1, a novel phosphatidylinositol 3-kinase-related protein kinase, associates with components of the mRNA surveillance complex and is involved in the regulation of nonsense-mediated mRNA decay.
11163187 2000 Human Upf proteins target an mRNA for nonsense-mediated decay when bound downstream of a termination codon.
11113196 2001 Identification and characterization of human orthologues to Saccharomyces cerevisiae Upf2 protein and Upf3 protein (Caenorhabditis elegans SMG-4).