Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
juvenile dermatomyositis 1187 4.7e-10
ovarian cancer 8520 2.6e-07
psoriasis 6694 7.1e-05
medulloblastoma, large-cell 6241 5.4e-04
glioblastoma 5792 7.6e-04
osteosarcoma 7950 1.0e-03
adult high grade glioma 3801 2.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.100 2.4e-03
glioblastoma -1.100 7.6e-04
juvenile dermatomyositis 1.071 4.7e-10
medulloblastoma, large-cell -1.600 5.4e-04
osteosarcoma -1.210 1.0e-03
ovarian cancer -1.500 2.6e-07
psoriasis -1.600 7.1e-05

Gene RIF (1)

AA Sequence

MPSVSKAAAAALSGSPPQTEKPTHYRYLKEFRTEQCPLFSQHKCAQHRPFTCFHWHFLNQRRRRPLRRRD      1 - 70
GTFNYSPDVYCSKYNEATGVCPDGDECPYLHRTTGDTERKYHLRYYKTGTCIHETDARGHCVKNGLHCAF     71 - 140
AHGPLDLRPPVCDVRELQAQEALQNGQLGGGEGVPDLQPGVLASQAMIEKILSEDPRWQDANFVLGSYKT    141 - 210
EQCPKPPRLCRQGYACPHYHNSRDRRRNPRRFQYRSTPCPSVKHGDEWGEPSRCDGGDGCQYCHSRTEQQ    211 - 280
FHPESTKCNDMRQTGYCPRGPFCAFAHVEKSLGMVNEWGCHDLHLTSPSSTGSGQPGNAKRRDSPAEGGP    281 - 350
RGSEQDSKQNHLAVFAAVHPPAPSVSSSVASSLASSAGSGSSSPTALPAPPARALPLGPASSTVEAVLGS    351 - 420
ALDLHLSNVNIASLEKDLEEQDGHDLGAAGPRSLAGSAPVAIPGSLPRAPSLHSPSSASTSPLGSLSQPL    421 - 490
PGPVGSSAMTPPQQPPPLRSEPGTLGSAASSYSPLGLNGVPGSIWDFVSGSFSPSPSPILSAGPPSSSSA    491 - 560
SPNGAELARVRRQLDEAKRKIRQWEESWQQVKQVCDAWQREAQEAKERARVADSDRQLALQKKEEVEAQV    561 - 630
IFQLRAKQCVACRERAHGAVLRPCQHHILCEPCAATAPECPYCKGQPLQW                        631 - 680
//

Text Mined References (14)

PMID Year Title