Property Summary

NCBI Gene PubMed Count 121
PubMed Score 680.85
PubTator Score 465.96

Knowledge Summary


No data available


  Differential Expression (8)

Disease log2 FC p
acute myeloid leukemia -1.800 3.8e-02
group 3 medulloblastoma 1.500 3.1e-04
lung cancer 2.000 8.4e-04
medulloblastoma, large-cell 1.100 1.1e-04
nasopharyngeal carcinoma 1.100 6.8e-05
non-small cell lung cancer 1.230 3.1e-17
osteosarcoma -1.839 1.1e-04
ovarian cancer 1.900 1.2e-04

 GO Component (2)

PDB (20)

Gene RIF (133)

AA Sequence

LSVYRGFFGCRHFSKTNELLQKSGKKPIDWKEL                                         281 - 313

Text Mined References (131)

PMID Year Title