Property Summary

NCBI Gene PubMed Count 24
PubMed Score 40.72
PubTator Score 29.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
ependymoma 1.500 7.4e-08
osteosarcoma 1.654 1.1e-05
atypical teratoid / rhabdoid tumor 1.500 2.1e-05
glioblastoma 1.800 1.2e-03
tuberculosis 1.100 9.5e-06
pediatric high grade glioma 1.600 6.2e-05
pilocytic astrocytoma 1.200 2.5e-05
lung carcinoma -1.900 1.2e-30

 GO Function (1)

Gene RIF (14)

PMID Text
26466955 Endosomal localization of endogenous TLR3 was decreased by silencing of LRRC59, suggesting that LRRC59 promotes UNC93B1-mediated translocation of NA-sensing TLRs from the ER upon infection.
25187660 the UNC93B1 tyrosine-based motif regulates trafficking and TLR responses via separate mechanisms.
23166319 TLR3 is the important regulator of UNC93B1 that in turn governs the responsiveness of all TLR3 as the important regulator of UNC93B1 that in turn governs the responsiveness of all NAS Toll-like receptors
23002119 IgM(+)IgD(+)CD27(+) but not switched B cells were strongly reduced in MYD88-, IRAK-4-, and TIRAP-deficient patients, but not UNC-93B-deficient patients.
22611194 UNC93B1 expression is required for TLR3 cleavage and signaling.
22164301 UNC93B1 physically associates with human TLR8 and regulates TLR8-mediated signaling
21173679 To date only 2 children with UNC-93B deficiencies have been identified after isolated HSV-1 encephalitis.
19120481 Individuals with congenital mutations develop severe HSV-1 encephalitis
19120473 regulates ligand-induced trafficking of TLR7 and TLR9 from the ER to endolysosomes, potential therapeutic target for controlling dysregulated TLR7/9 responses in autoimmune diseases
19006693 IRAK-4-, MyD88-, and UNC-93B-deficient patients did not display autoreactive antibodies in their serum or develop autoimmune diseases, suggesting that IRAK-4, MyD88, and UNC-93B pathway blockade may thwart autoimmunity in humans.
18241724 No UNC-93B1 mutations were foundin patients with MRS.
18082565 study confirms the function of UNC-93B for innate immunity in human beings, and extends the knowledge for this molecule to the analysis of its regulation and the subcellular localization of the endogenous protein
16973841 findings elucidate a genetic etiology for herpes simplex virus encephalitis in two children with autosomal recessive deficiency in the intracellular protein UNC-93B, resulting in impaired cellular interferon-alpha/beta and -lambda antiviral responses
16111919 Haplotype H3 of the hUNC-93B1 gene seems related to E/A-ratio in elderly men. The relationship between the hUNC-93B1 gene and the age at onset of heart failure and mortality support a view of a clinically relevant impact of the gene.

AA Sequence

MEAEPPLYPMAGAAGPQGDEDLLGVPDGPEAPLDELVGAYPNYNEEEEERRYYRRKRLGVLKNVLAASAG      1 - 70
GMLTYGVYLGLLQMQLILHYDETYREVKYGNMGLPDIDSKMLMGINVTPIAALLYTPVLIRFFGTKWMMF     71 - 140
LAVGIYALFVSTNYWERYYTLVPSAVALGMAIVPLWASMGNYITRMAQKYHEYSHYKEQDGQGMKQRPPR    141 - 210
GSHAPYLLVFQAIFYSFFHLSFACAQLPMIYFLNHYLYDLNHTLYNVQSCGTNSHGILSGFNKTVLRTLP    211 - 280
RSGNLIVVESVLMAVAFLAMLLVLGLCGAAYRPTEEIDLRSVGWGNIFQLPFKHVRDYRLRHLVPFFIYS    281 - 350
GFEVLFACTGIALGYGVCSVGLERLAYLLVAYSLGASAASLLGLLGLWLPRPVPLVAGAGVHLLLTFILF    351 - 420
FWAPVPRVLQHSWILYVAAALWGVGSALNKTGLSTLLGILYEDKERQDFIFTIYHWWQAVAIFTVYLGSS    421 - 490
LHMKAKLAVLLVTLVAAAVSYLRMEQKLRRGVAPRQPRIPRPQHKVRGYRYLEEDNSDESDAEGEHGDGA    491 - 560
EEEAPPAGPRPGPEPAGLGRRPCPYEQAQGGDGPEEQ                                     561 - 597
//

Text Mined References (29)

PMID Year Title
26466955 2015 LRRC59 Regulates Trafficking of Nucleic Acid-Sensing TLRs from the Endoplasmic Reticulum via Association with UNC93B1.
25187660 2014 Cutting edge: the UNC93B1 tyrosine-based motif regulates trafficking and TLR responses via separate mechanisms.
24439965 2014 Trafficking of endosomal Toll-like receptors.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23166319 2013 The role of UNC93B1 protein in surface localization of TLR3 receptor and in cell priming to nucleic acid agonists.
23002119 2012 IgM+IgD+CD27+ B cells are markedly reduced in IRAK-4-, MyD88-, and TIRAP- but not UNC-93B-deficient patients.
22611194 2012 Cleavage of Toll-like receptor 3 by cathepsins B and H is essential for signaling.
22164301 2011 UNC93B1 physically associates with human TLR8 and regulates TLR8-mediated signaling.
21642595 2011 BAD-LAMP is a novel biomarker of nonactivated human plasmacytoid dendritic cells.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21173679 2011 Is it time to study TLR3 or UNC-93B pathway deficiencies in reactivated herpes simplex encephalitis?
19369195 2009 Large-scale proteomics analysis of the human kinome.
19120481 2009 Crosstalk between components of the innate immune system: promoting anti-microbial defenses and avoiding immunopathologies.
19120473 2009 Regulatory molecules required for nucleotide-sensing Toll-like receptors.
19006693 2008 IRAK-4- and MyD88-dependent pathways are essential for the removal of developing autoreactive B cells in humans.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18241724 2008 Melkersson-Rosenthal syndrome.
18082565 2007 Assessing the function of human UNC-93B in Toll-like receptor signaling and major histocompatibility complex II response.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16973841 2006 Herpes simplex virus encephalitis in human UNC-93B deficiency.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16111919 2005 hUNC-93B1, a novel gene mainly expressed in the heart, is related to left ventricular diastolic function, heart failure morbidity and mortality in elderly men.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11867227 2002 hUNC93B1: a novel human gene representing a new gene family and encoding an unc-93-like protein.
9847074 1998 Toward a complete human genome sequence.
9110174 1997 Large-scale concatenation cDNA sequencing.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8619474 1996 A "double adaptor" method for improved shotgun library construction.