Property Summary

NCBI Gene PubMed Count 34
PubMed Score 38.99
PubTator Score 28.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -1.700 6.5e-03
posterior fossa group B ependymoma -2.400 4.4e-09
oligodendroglioma -1.400 2.7e-02
glioblastoma -2.500 1.3e-05
osteosarcoma -1.265 4.1e-02
atypical teratoid / rhabdoid tumor -1.700 3.3e-03
medulloblastoma, large-cell -1.500 1.0e-03
primitive neuroectodermal tumor -1.300 3.5e-02
adrenocortical carcinoma -1.772 2.8e-03
active ulcerative colitis -1.041 3.0e-02
pediatric high grade glioma -2.300 1.6e-07
group 4 medulloblastoma -2.100 5.9e-06
subependymal giant cell astrocytoma -2.342 3.4e-03
Breast cancer -1.200 7.9e-06
psoriasis -1.100 8.4e-16

Protein-protein Interaction (1)

Gene RIF (23)

PMID Text
26859457 identify the V-2 domain of netrin-1 to be important for its interaction with the Ig1/Ig2 domains of UNC5H2
25419706 T835M (rs137875858) in the UNC5C was associated with late-onset Alzheimer disease and increased cell death in HEK293 cells.
25316812 we have identified novel frequent somatic mutations of UNC5C in muscle-invasive bladder cancers.
24866402 The rare coding variant might not play an important role in AD risk in mainland China.
24415873 UNC5C mutations are very rare in familial and sporadic colorectal carcinomas.
23178624 TNM stage 1 hepatocellular carcinoma (HCC) presented UNC5C methylation, indicating that the UNC5C gene has been methylated from the early stages of HCC.
22685302 knockdown of DSCAM inhibits netrin-induced tyrosine phosphorylation of UNC5C and Fyn as well as the interaction of UNC5C with Fyn. The double knockdown of both receptors abolishes the induction of Fyn tyrosine phosphorylation by netrin-1
21893118 Inherited mutations in UNC5C prevent apoptosis and increase risk of colorectal cancer.
21600761 UNC5C acts as a tumour suppressor in RCC and is down-regulated in RCC. Loss of heterozygosity and DNA methylation contribute to the inactivation of UNC5C in renal cell carcinoma.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20032384 UNC5C methylation was observed in the course of gastric carcinogenesis and disappeared in highly advanced gastric carcinomas.
19850283 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19822088 Stronger expression of UNC5B and UNC5C receptors in synovial fibroblasts might contribute to the disordered phenotype of rheumatoid arthritis and osteoarthritis.
19475631 Meta-analysis of gene-disease association. (HuGE Navigator)
19331160 UNC5C might act as a tumor suppressor and UNC5C methylation might present a malignant potential in colorectal cancer.
19242752 Aberrant methylation of the netrin-1 receptor genes UNC5C and DCC detected in advanced colorectal cancer.
18628988 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18054557 study provides evidence that most colorectal cancers have alterations in both UNC5C and DCC netrin receptors; while UNC5C expression is regulated primarily via epigenetic regulation, DCC defects are mediated through allelic deletions
17967459 The loss of UNC5C expression observed in human colorectal cancer is a selective advantage for tumor progression
16371650 Data suggest a model in which netrin stimulates UNC5 tyrosine phosphorylation and signaling in a manner dependent on the co-receptor DCC, through the recruitment of Src and FAK kinases.
15574733 Netrin binds through multiple domains to both DCC and Unc5c. in Caenorhabditis elegans indicate that both netrin binding and nonbinding domains are necessary for phenotypic rescue of an unc-5 loss of function mutation.
12655055 may represent tumor suppressor that inhibit tumor extension outside the region of netrin-1 availability by inducing apoptosis

AA Sequence

MRKGLRATAARCGLGLGYLLQMLVLPALALLSASGTGSAAQDDDFFHELPETFPSDPPEPLPHFLIEPEE      1 - 70
AYIVKNKPVNLYCKASPATQIYFKCNSEWVHQKDHIVDERVDETSGLIVREVSIEISRQQVEELFGPEDY     71 - 140
WCQCVAWSSAGTTKSRKAYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPVAEVEWLKNEDIIDP    141 - 210
VEDRNFYITIDHNLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIVYVNGGWSTWTEWSVCNSRCGRGY    211 - 280
QKRTRTCTNPAPLNGGAFCEGQSVQKIACTTLCPVDGRWTPWSKWSTCGTECTHWRRRECTAPAPKNGGK    281 - 350
DCDGLVLQSKNCTDGLCMQTAPDSDDVALYVGIVIAVIVCLAISVVVALFVYRKNHRDFESDIIDSSALN    351 - 420
GGFQPVNIKAARQDLLAVPPDLTSAAAMYRGPVYALHDVSDKIPMTNSPILDPLPNLKIKVYNTSGAVTP    421 - 490
QDDLSEFTSKLSPQMTQSLLENEALSLKNQSLARQTDPSCTAFGSFNSLGGHLIVPNSGVSLLIPAGAIP    491 - 560
QGRVYEMYVTVHRKETMRPPMDDSQTLLTPVVSCGPPGALLTRPVVLTMHHCADPNTEDWKILLKNQAAQ    561 - 630
GQWEDVVVVGEENFTTPCYIQLDAEACHILTENLSTYALVGHSTTKAAAKRLKLAIFGPLCCSSLEYSIR    631 - 700
VYCLDDTQDALKEILHLERQMGGQLLEEPKALHFKGSTHNLRLSIHDIAHSLWKSKLLAKYQEIPFYHVW    701 - 770
SGSQRNLHCTFTLERFSLNTVELVCKLCVRQVEGEGQIFQLNCTVSEEPTGIDLPLLDPANTITTVTGPS    771 - 840
AFSIPLPIRQKLCSSLDAPQTRGHDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQNFPDGNLSMLA    841 - 910
AVLEEMGRHETVVSLAAEGQY                                                     911 - 931
//

Text Mined References (35)

PMID Year Title
26859457 2016 Structural Decoding of the Netrin-1/UNC5 Interaction and its Therapeutical Implications in Cancers.
25419706 2014 A rare mutation in UNC5C predisposes to late-onset Alzheimer's disease and increases neuronal cell death.
25316812 2014 Whole-exome sequencing of muscle-invasive bladder cancer identifies recurrent mutations of UNC5C and prognostic importance of DNA repair gene mutations on survival.
24866402 2014 Investigation of TREM2, PLD3, and UNC5C variants in patients with Alzheimer's disease from mainland China.
24415873 2014 Evaluation of the colorectal cancer risk conferred by rare UNC5C alleles.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23178624 Methylation of the UNC5C gene is frequently detected in hepatocellular carcinoma.
22685302 2012 Down syndrome cell adhesion molecule (DSCAM) associates with uncoordinated-5C (UNC5C) in netrin-1-mediated growth cone collapse.
21893118 2011 Variants in the netrin-1 receptor UNC5C prevent apoptosis and increase risk of familial colorectal cancer.
21600761 2011 Genetic and epigenetic control of UNC5C expression in human renal cell carcinoma.
20932310 2010 Genome-wide association reveals genetic effects on human A?42 and ? protein levels in cerebrospinal fluids: a case control study.
20395239 2010 Genome-wide association identifies ATOH7 as a major gene determining human optic disc size.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
20032384 2009 Changes in UNC5C gene methylation during human gastric carcinogenesis.
19850283 2010 Identification of novel candidate genes for treatment response to risperidone and susceptibility for schizophrenia: integrated analysis among pharmacogenomics, mouse expression, and genetic case-control association approaches.
19822088 Role of the netrin system of repellent factors on synovial fibroblasts in rheumatoid arthritis and osteoarthritis.
19475631 2010 Non-replication of association for six polymorphisms from meta-analysis of genome-wide association studies of Parkinson's disease: large-scale collaborative study.
19331160 2009 Aberrant methylation of the UNC5C gene is frequently detected in advanced colorectal cancer.
19242752 2009 Aberrant methylation of the netrin-1 receptor genes UNC5C and DCC detected in advanced colorectal cancer.
18628988 2008 Neither replication nor simulation supports a role for the axon guidance pathway in the genetics of Parkinson's disease.
18054557 2007 Epigenetic and genetic alterations in Netrin-1 receptors UNC5C and DCC in human colon cancer.
17967459 2007 Inactivation of the UNC5C Netrin-1 receptor is associated with tumor progression in colorectal malignancies.
16371650 2006 FAK and Src kinases are required for netrin-induced tyrosine phosphorylation of UNC5.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15729359 2005 The dependence receptor UNC5H2 mediates apoptosis through DAP-kinase.
15574733 2004 Mapping netrin receptor binding reveals domains of Unc5 regulating its tyrosine phosphorylation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12810718 2003 Netrin binds discrete subdomains of DCC and UNC5 and mediates interactions between DCC and heparin.
12655055 2003 The netrin-1 receptors UNC5H are putative tumor suppressors controlling cell death commitment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11213262 1999 Netrins and netrin receptors.
11103947 2000 Cellular mechanisms of netrin function: long-range and short-range actions.
9782087 1998 Cloning and mapping of the UNC5C gene to human chromosome 4q21-q23.