Property Summary

NCBI Gene PubMed Count 36
PubMed Score 46.24
PubTator Score 36.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
psoriasis 2.500 9.9e-05
osteosarcoma 2.556 4.6e-06
primary pancreatic ductal adenocarcinoma 1.709 9.2e-04
X-linked cerebral adrenoleukodystrophy 1.700 2.3e-02
breast carcinoma 1.500 4.5e-03
interstitial cystitis -1.800 3.1e-04
atypical teratoid/rhabdoid tumor -1.100 1.2e-02
invasive ductal carcinoma 1.700 8.7e-03
non-inflammatory breast cancer 1.900 1.0e-03
Polycystic Ovary Syndrome -1.491 6.4e-03
ductal carcinoma in situ 1.700 1.1e-03
ulcerative colitis -1.400 2.3e-05
ovarian cancer 2.500 4.4e-07
pancreatic cancer 1.500 6.2e-03

Protein-protein Interaction (2)

Gene RIF (23)

PMID Text
24584118 unc5b expression is greater in adipose tissue of obese versus lean subjects.
24528886 UNC5B expression is decreased in bladder cancer cells compared to normal bladder cell lines.
24122613 Data indicate that dysregulation of expression of netrin-1 NTN1 in smooth muscle cell (SMC) and its chemorepulsive receptor UNC5B in macrophages are involved in the development of atherosclerosis and unstable plaques.
23666553 Higher netrin-1 and lower UNC5B expression in all prostate carcinoma cell lines indicated that netrin-1 and UNC5B could be used to predict metastasis.
23599441 UNC5B protein expressed in macrophages in hypoxic regions of atherosclerotic regions in human.
23526078 UNC5B was downregulated in kidney carcinoma.
23312517 Reducing Unc5b levels in Sip1 knockout slices and brains rescues cell migration in cortical interneurons.
23055195 Low UNC5B expression was an independent risk factor for postoperative recurrence in patients with different stages and grades bladder cancer.
22252496 Hypoxia-inducible factor 1 controls the expression of the uncoordinated-5-B receptor, but not of netrin-1, in first trimester human placenta
21922135 The mRNA expression analysis using tissue samples revealed that UNC5B mRNA was down-expressed in about 20% of CRC patients, and the patients with low-UNC5B-expression tumors showed a significantly higher recurrence rate after curative surgery.
21238923 Robo4 specifically binds to UNC5B, a vascular Netrin receptor, revealing unexpected interactions between two endothelial guidance receptors.
21172653 The recruitment of PP2A to UNC5H2/B allows the activation of DAPk via a PP2A-mediated dephosphorylation and that this mechanism is involved in angiogenesis regulation.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20092749 Down-regulation of UNC5b gene expression is related to angiogenesis of hepatocellular carcinoma.
19826074 UNC5B receptor is localized to villous and extravillous cytotrophoblasts proximal to anchoring areas during the first trimester.
19822088 Stronger expression of UNC5B and UNC5C receptors in synovial fibroblasts might contribute to the disordered phenotype of rheumatoid arthritis and osteoarthritis.
19570425 Netrin-1 can promote the potential of proliferation and invasion of extravillous trophoblasts in vitro through its receptors neogenin and UNC5B.
19273616 In this study, we show that Unc5B, a member of the netrin receptor family, interacts with neogenin as a coreceptor for RGMa.
18719102 Knockdown of Netrin-4 expression in EC increased their ability to form tubular structures; Netrin-4 bound only to neogenin but not to Unc5B or Unc5C receptors
18469807 PIKE-L acts as a downstream survival effector for netrin-1 through UNC5B in the nervous system
16385451 Observational study of gene-disease association. (HuGE Navigator)
12655055 may represent tumor suppressor that inhibit tumor extension outside the region of netrin-1 availability by inducing apoptosis
12359238 Modulation of G(ialpha(2)) signaling by the axonal guidance of this protein

AA Sequence

MGARSGARGALLLALLLCWDPRLSQAGTDSGSEVLPDSFPSAPAEPLPYFLQEPQDAYIVKNKPVELRCR      1 - 70
AFPATQIYFKCNGEWVSQNDHVTQEGLDEATGLRVREVQIEVSRQQVEELFGLEDYWCQCVAWSSAGTTK     71 - 140
SRRAYVRIAYLRKNFDQEPLGKEVPLDHEVLLQCRPPEGVPVAEVEWLKNEDVIDPTQDTNFLLTIDHNL    141 - 210
IIRQARLSDTANYTCVAKNIVAKRRSTTATVIVYVNGGWSSWAEWSPCSNRCGRGWQKRTRTCTNPAPLN    211 - 280
GGAFCEGQAFQKTACTTICPVDGAWTEWSKWSACSTECAHWRSRECMAPPPQNGGRDCSGTLLDSKNCTD    281 - 350
GLCMQNKKTLSDPNSHLLEASGDAALYAGLVVAIFVVVAILMAVGVVVYRRNCRDFDTDITDSSAALTGG    351 - 420
FHPVNFKTARPSNPQLLHPSVPPDLTASAGIYRGPVYALQDSTDKIPMTNSPLLDPLPSLKVKVYSSSTT    421 - 490
GSGPGLADGADLLGVLPPGTYPSDFARDTHFLHLRSASLGSQQLLGLPRDPGSSVSGTFGCLGGRLSIPG    491 - 560
TGVSLLVPNGAIPQGKFYEMYLLINKAESTLPLSEGTQTVLSPSVTCGPTGLLLCRPVILTMPHCAEVSA    561 - 630
RDWIFQLKTQAHQGHWEEVVTLDEETLNTPCYCQLEPRACHILLDQLGTYVFTGESYSRSAVKRLQLAVF    631 - 700
APALCTSLEYSLRVYCLEDTPVALKEVLELERTLGGYLVEEPKPLMFKDSYHNLRLSLHDLPHAHWRSKL    701 - 770
LAKYQEIPFYHIWSGSQKALHCTFTLERHSLASTELTCKICVRQVEGEGQIFQLHTTLAETPAGSLDTLC    771 - 840
SAPGSTVTTQLGPYAFKIPLSIRQKICNSLDAPNSRGNDWRMLAQKLSMDRYLNYFATKASPTGVILDLW    841 - 910
EALQQDDGDLNSLASALEEMGKSEMLVAVATDGDC                                       911 - 945
//

Text Mined References (39)

PMID Year Title
26235030 2015 Structural Basis of Latrophilin-FLRT-UNC5 Interaction in Cell Adhesion.
26190107 2015 A Floor-Plate Extracellular Protein-Protein Interaction Screen Identifies Draxin as a Secreted Netrin-1 Antagonist.
25374360 2014 FLRT structure: balancing repulsion and cell adhesion in cortical and vascular development.
24584118 2014 Netrin-1 promotes adipose tissue macrophage retention and insulin resistance in obesity.
24528886 2014 PKC ? regulates netrin-1/UNC5B-mediated survival pathway in bladder cancer.
24122613 2013 Association of neuroimmune guidance cue netrin-1 and its chemorepulsive receptor UNC5B with atherosclerotic plaque expression signatures and stability in human(s): Tampere Vascular Study (TVS).
23666553 2013 Interactional expression of netrin-1 and its dependence receptor UNC5B in prostate carcinoma.
23599441 2013 Hypoxia induces netrin-1 and Unc5b in atherosclerotic plaques: mechanism for macrophage retention and survival.
23526078 2013 PKC? is involved in the progression of kidney carcinoma through regulating netrin-1/UNC5B signaling pathway.
23312517 2013 Directed migration of cortical interneurons depends on the cell-autonomous action of Sip1.
23055195 2013 Clinical significance of UNC5B expression in bladder cancer.
22951725 2013 Association analyses identify three susceptibility Loci for vitiligo in the Chinese Han population.
22252496 2011 Hypoxia-inducible factor 1 controls the expression of the uncoordinated-5-B receptor, but not of netrin-1, in first trimester human placenta.
21922135 2012 Clinical significance of UNC5B expression in colorectal cancer.
21238923 2011 Robo4 maintains vessel integrity and inhibits angiogenesis by interacting with UNC5B.
21172653 2010 The dependence receptor UNC5H2/B triggers apoptosis via PP2A-mediated dephosphorylation of DAP kinase.
20693423 2010 Netrin-1 regulates Th1/Th2/Th17 cytokine production and inflammation through UNC5B receptor and protects kidney against ischemia-reperfusion injury.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20092749 2009 [Down-regulated expression of UNC5b related to hepatocellular carcinoma angiogenesis].
19826074 2010 Characterization and expression of netrin-1 and its receptors UNC5B and DCC in human placenta.
19822088 Role of the netrin system of repellent factors on synovial fibroblasts in rheumatoid arthritis and osteoarthritis.
19570425 2009 [Correlation of netrin-1 expression with invasion of extra villous trophoblasts].
19273616 2009 Unc5B associates with LARG to mediate the action of repulsive guidance molecule.
18839057 2008 Molecular genetics of adult ADHD: converging evidence from genome-wide association and extended pedigree linkage studies.
18719102 2008 Netrin-4 inhibits angiogenesis via binding to neogenin and recruitment of Unc5B.
18582460 2008 Lipid raft localization and palmitoylation: identification of two requirements for cell death induction by the tumor suppressors UNC5H.
18469807 2008 Netrin-1 mediates neuronal survival through PIKE-L interaction with the dependence receptor UNC5B.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15729359 2005 The dependence receptor UNC5H2 mediates apoptosis through DAP-kinase.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12655055 2003 The netrin-1 receptors UNC5H are putative tumor suppressors controlling cell death commitment.
12598906 2003 p53RDL1 regulates p53-dependent apoptosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12359238 2002 Modulation of G(ialpha(2)) signaling by the axonal guidance molecule UNC5H2.
12107411 2002 Expressed sequence tag analysis of human retina for the NEIBank Project: retbindin, an abundant, novel retinal cDNA and alternative splicing of other retina-preferred gene transcripts.