Property Summary

NCBI Gene PubMed Count 16
PubMed Score 19.92
PubTator Score 4.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Cystadenoma 7 3.448 1.7
Diamond-Blackfan anemia 30 3.184 1.6

Expression

Gene RIF (7)

PMID Text
26438524 UNC-45A is a crucial component in regulating human NK cell cytoskeletal dynamics via promoting the formation of actomyosin complexes.
25444911 Findings identify a novel centrosomal function for UNC45A and its role in cell proliferation and tumorigenesis.
22190034 HIV-1 IN is identified to have a physical interaction with unc-45 homolog A (C. elegans) (UNC45A) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21802425 The authors found that UNC-45A is alternatively expressed at the mRNA and protein levels as two isoforms and that the two isoforms differ only by a proline-rich 15-amino-acid sequence near the amino-terminus.
18285346 GCUNC45 is required for the normal cellular distribution of Hsp90beta, but not Hsp90alpha.
17872978 elevated GC UNC-45 protein expression in ovarian carcinoma proliferation and metastasis.
16478993 GCUNC-45 is a novel modulator of progesterone receptor chaperoning by hsp90.

AA Sequence

MTVSGPGTPEPRPATPGASSVEQLRKEGNELFKCGDYGGALAAYTQALGLDATPQDQAVLHRNRAACHLK      1 - 70
LEDYDKAETEASKAIEKDGGDVKALYRRSQALEKLGRLDQAVLDLQRCVSLEPKNKVFQEALRNIGGQIQ     71 - 140
EKVRYMSSTDAKVEQMFQILLDPEEKGTEKKQKASQNLVVLAREDAGAEKIFRSNGVQLLQRLLDMGETD    141 - 210
LMLAALRTLVGICSEHQSRTVATLSILGTRRVVSILGVESQAVSLAACHLLQVMFDALKEGVKKGFRGKE    211 - 280
GAIIVDPARELKVLISNLLDLLTEVGVSGQGRDNALTLLIKAVPRKSLKDPNNSLTLWVIDQGLKKILEV    281 - 350
GGSLQDPPGELAVTANSRMSASILLSKLFDDLKCDAERENFHRLCENYIKSWFEGQGLAGKLRAIQTVSC    351 - 420
LLQGPCDAGNRALELSGVMESVIALCASEQEEEQLVAVEALIHAAGKAKRASFITANGVSLLKDLYKCSE    421 - 490
KDSIRIRALVGLCKLGSAGGTDFSMKQFAEGSTLKLAKQCRKWLCNDQIDAGTRRWAVEGLAYLTFDADV    491 - 560
KEEFVEDAAALKALFQLSRLEERSVLFAVASALVNCTNSYDYEEPDPKMVELAKYAKQHVPEQHPKDKPS    561 - 630
FVRARVKKLLAAGVVSAMVCMVKTESPVLTSSCRELLSRVFLALVEEVEDRGTVVAQGGGRALIPLALEG    631 - 700
TDVGQTKAAQALAKLTITSNPEMTFPGERIYEVVRPLVSLLHLNCSGLQNFEALMALTNLAGISERLRQK    701 - 770
ILKEKAVPMIEGYMFEEHEMIRRAATECMCNLAMSKEVQDLFEAQGNDRLKLLVLYSGEDDELLQRAAAG    771 - 840
GLAMLTSMRPTLCSRIPQVTTHWLEILQALLLSSNQELQHRGAVVVLNMVEASREIASTLMESEMMEILS    841 - 910
VLAKGDHSPVTRAAAACLDKAVEYGLIQPNQDGE                                        911 - 944
//

Text Mined References (25)

PMID Year Title
26438524 2015 UNC-45A Is a Nonmuscle Myosin IIA Chaperone Required for NK Cell Cytotoxicity via Control of Lytic Granule Secretion.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25487020 2015 UCS proteins: chaperones for myosin and co-chaperones for Hsp90.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25444911 2015 UNC45A localizes to centrosomes and regulates cancer cell proliferation through ChK1 activation.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21802425 2011 Differential turnover of myosin chaperone UNC-45A isoforms increases in metastatic human breast cancer.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18285346 2008 GCUNC45 is the first Hsp90 co-chaperone to show alpha/beta isoform specificity.
17872978 2007 Myosin II co-chaperone general cell UNC-45 overexpression is associated with ovarian cancer, rapid proliferation, and motility.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16478993 2006 GCUNC-45 is a novel regulator for the progesterone receptor/hsp90 chaperoning pathway.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12356907 2002 Two mammalian UNC-45 isoforms are related to distinct cytoskeletal and muscle-specific functions.
12119110 2002 Cloning, characterization and chromosome mapping of the human SMAP1 gene.