Property Summary

NCBI Gene PubMed Count 30
PubMed Score 96.78
PubTator Score 16.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.100 2.7e-03
group 3 medulloblastoma 1.800 2.9e-05

 GO Function (1)

 OMIM Phenotype (1)

Gene RIF (15)

PMID Text
23535298 UNC119a bridges the transmission of Fyn signals to Rab11, leading to the completion of cytokinesis.
23227982 Expression of SH3/SH2 ligand-uncoordinated 119 (UNC119) completely reverses the HIV-1 Nef-mediated inhibition of immunological synapse recruitment of LCK
23072788 The profile of UNC119a subcellular distribution remained largely unchanged under all tested conditions of illumination, and correlated with the profile of Galpha(t1) following its light-dependent translocation.
22960633 Crystal structures of Arl3 in complex with UNC119a reveal the molecular basis of specificity. The N-terminal amphipathic helix of Arl3.GppNHp is not displaced by the interswitch toggle but remains bound on the surface of the protein
22729960 The discovery of the UNC119 defect provides a molecular mechanism for a subset of patients with this previously unexplained disease. Here we review our recent findings on the UNC119 mutation in ICL.
22123847 Expression of SH3/SH2 ligand-uncoordinated 119 (UNC119) completely reverses the HIV-1 Nef-mediated inhibition of immunological synapse recruitment of LCK
21712387 Interaction of transducin with uncoordinated 119 protein (UNC119): implications for the model of transducin trafficking in rod photoreceptors.
21642972 This study demonistrated that UNC119 is a Galpha subunit cofactor essential for G protein trafficking in sensory cilia.
20801516 Observational study of genetic testing. (HuGE Navigator)
20220094 Heightened expression of Unc119 promotes T helper type (Th)2 cells, inhibits Th1 cell differentiation, and contributes to the pathogenesis of asthma in humans.
19781630 demonstrate a role for Unc119 in clathrin- and caveolae-based endocytosis as well as macropinocytosis. Depletion of Unc119 in fibroblasts increases FM4-64, albumin, viruses, and ligand-coated beads.
19592652 Unc119 orchestrates the recruitment of the actin-based motor protein, myosin 5B, and the organization of multiprotein complexes on endosomes. The Unc119-regulated pathway is essential for immunological synapse formation and T cell activation.
17579091 Unc119 plays an important role in fibrotic processes through myofibroblast differentiation; Unc119 increases the kinase activity of Fyn and associates with it in coprecipitation and colocalization studies.
12527357 The presence of ARL2 in the retina and co-localization with HRG4 was confirmed. Amino acid residues of PDEdelta involved in binding ARL2 and forming a hydrophobic pocket were shown to be highly conserved in HRG4
12496276 identification as activator of SRC-type tyrosine kinases

AA Sequence

MKVKKGGGGAGTATESAPGPSGQSVAPIPQPPAESESGSESEPDAGPGPRPGPLQRKQPIGPEDVLGLQR      1 - 70
ITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPPVSERLPINRRDLDPNAGRFVRYQFTPAFLRL     71 - 140
RQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRH    141 - 210
PYETQSDSFYFVDDRLVMHNKADYSYSGTP                                            211 - 240
//

Text Mined References (34)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
25416956 2014 A proteome-scale map of the human interactome network.
23535298 2013 UNC119a bridges the transmission of Fyn signals to Rab11, leading to the completion of cytokinesis.
23072788 2013 Expression and subcellular distribution of UNC119a, a protein partner of transducin ? subunit in rod photoreceptors.
22960633 2012 Structural basis for Arl3-specific release of myristoylated ciliary cargo from UNC119.
22729960 2012 Consequences of a mutation in the UNC119 gene for T cell function in idiopathic CD4 lymphopenia.
22184408 2012 A mutation in the human Uncoordinated 119 gene impairs TCR signaling and is associated with CD4 lymphopenia.
22085962 2011 An ARL3-UNC119-RP2 GTPase cycle targets myristoylated NPHP3 to the primary cilium.
21712387 2011 Interaction of transducin with uncoordinated 119 protein (UNC119): implications for the model of transducin trafficking in rod photoreceptors.
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
21642972 2011 UNC119 is required for G protein trafficking in sensory neurons.
20801516 2011 Simultaneous mutation detection in 90 retinal disease genes in multiple patients using a custom-designed 300-kb retinal resequencing chip.
20220094 2010 Uncoordinated 119 preferentially induces Th2 differentiation and promotes the development of asthma.
19781630 2010 UNC119 inhibits dynamin and dynamin-dependent endocytic processes.
19592652 2009 Uncoordinated 119 protein controls trafficking of Lck via the Rab11 endosome and is critical for immunological synapse formation.
19381274 2009 Unc119 protects from Shigella infection by inhibiting the Abl family kinases.
18588884 2008 Specificity of Arl2/Arl3 signaling is mediated by a ternary Arl3-effector-GAP complex.
17579091 2007 Unc119 regulates myofibroblast differentiation through the activation of Fyn and the p38 MAPK pathway.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16341674 2005 Transcriptome analysis of human gastric cancer.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14757743 2004 Unc119, a novel activator of Lck/Fyn, is essential for T cell activation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12527357 2003 Photoreceptor synaptic protein HRG4 (UNC119) interacts with ARL2 via a putative conserved domain.
12496276 2003 Identification of UNC119 as a novel activator of SRC-type tyrosine kinases.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11303027 2001 ADP-ribosylation factors (ARFs) and ARF-like 1 (ARL1) have both specific and shared effectors: characterizing ARL1-binding proteins.
11006213 2000 HRG4 (UNC119) mutation found in cone-rod dystrophy causes retinal degeneration in a transgenic model.
10329014 1999 Characterization of the gene for HRG4 (UNC119), a novel photoreceptor synaptic protein homologous to unc-119.
9761287 1998 Mammalian orthologs of C. elegans unc-119 highly expressed in photoreceptors.
9538874 1998 Localization of HRG4, a photoreceptor protein homologous to Unc-119, in ribbon synapse.
8576185 1996 Cloning of the cDNA for a novel photoreceptor protein.