Property Summary

Ligand Count 1
NCBI Gene PubMed Count 34
PubMed Score 109.46
PubTator Score 16.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma 1.800 2.9e-05
psoriasis 1.100 2.7e-03

 GO Function (1)

 OMIM Phenotype (1)

Gene RIF (18)

AA Sequence

MKVKKGGGGAGTATESAPGPSGQSVAPIPQPPAESESGSESEPDAGPGPRPGPLQRKQPIGPEDVLGLQR      1 - 70
ITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPPVSERLPINRRDLDPNAGRFVRYQFTPAFLRL     71 - 140
RQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRH    141 - 210
PYETQSDSFYFVDDRLVMHNKADYSYSGTP                                            211 - 240
//

Text Mined References (38)

PMID Year Title