Property Summary

Ligand Count 3
NCBI Gene PubMed Count 48
PubMed Score 176.15
PubTator Score 261.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count
Malignant tumor of stomach 12
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count
Orotic aciduria 18

Expression

  Differential Expression (16)

Disease log2 FC p
acute myeloid leukemia -1.400 2.6e-02
adult high grade glioma 1.100 5.3e-05
Astrocytoma, Pilocytic 1.200 1.0e-07
atypical teratoid / rhabdoid tumor 1.200 1.4e-07
Breast cancer 2.100 4.4e-02
ependymoma 1.200 3.3e-13
glioblastoma 1.500 2.4e-10
group 3 medulloblastoma 2.000 2.3e-07
hepatocellular carcinoma 1.200 8.8e-05
lung cancer 2.200 4.8e-04
malignant mesothelioma 1.500 6.5e-07
medulloblastoma, large-cell 1.100 2.1e-04
non-small cell lung cancer 1.154 6.0e-16
ovarian cancer 1.600 1.2e-04
pituitary cancer 1.100 2.3e-06
primitive neuroectodermal tumor 1.300 1.7e-05

 OMIM Phenotype (1)

Protein-protein Interaction (1)

PDB (38)

Gene RIF (35)

AA Sequence

MAVARAALGPLVTGLYDVQAFKFGDFVLKSGLSSPIYIDLRGIVSRPRLLSQVADILFQTAQNAGISFDT      1 - 70
VCGVPYTALPLATVICSTNQIPMLIRRKETKDYGTKRLVEGTINPGETCLIIEDVVTSGSSVLETVEVLQ     71 - 140
KEGLKVTDAIVLLDREQGGKDKLQAHGIRLHSVCTLSKMLEILEQQKKVDAETVGRVKRFIQENVFVAAN    141 - 210
HNGSPLSIKEAPKELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICML    211 - 280
KTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGV    281 - 350
VKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQ    351 - 420
LEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLGV              421 - 480
//

Text Mined References (57)

PMID Year Title