Property Summary

NCBI Gene PubMed Count 46
PubMed Score 171.11
PubTator Score 261.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
hepatocellular carcinoma 1.200 8.8e-05
malignant mesothelioma 2.100 9.4e-07
posterior fossa group A ependymoma 1.300 8.9e-12
glioblastoma 1.500 2.4e-10
group 3 medulloblastoma 2.000 2.3e-07
atypical teratoid/rhabdoid tumor 1.400 1.2e-10
medulloblastoma, large-cell 1.100 2.1e-04
primitive neuroectodermal tumor 1.300 1.7e-05
non-small cell lung cancer 1.154 6.0e-16
lung cancer 2.200 4.8e-04
Breast cancer 2.100 4.4e-02
pediatric high grade glioma 1.400 1.5e-09
pilocytic astrocytoma 1.200 1.3e-07
acute myeloid leukemia -1.400 2.6e-02
ovarian cancer 1.600 1.2e-04
pituitary cancer 1.100 2.3e-06

 OMIM Phenotype (1)

Protein-protein Interaction (2)

Gene RIF (33)

PMID Text
24158442 OPRT transition state analogues identify crucial components of potent inhibitors targeting OPRT enzymes.
22931617 OPRT expression in colorectal carcinoma tissues is not correlated with the toxicity of 5-FU, but OPRT expression in the normal tissues can help predict the toxicity associated with 5-FU.
22641663 High expression levels of orotate phosphoribosyl transferase and thymidylate synthase in colorectal cancer appear to be significantly involved in metastasis after curative surgery
22249354 The observed mutations, aberrant splicing and downregulation of UMPS represent novel mechanisms for acquired 5-FU resistance in colorectal cancer
21631301 Although no association was detected between UMPS variants and gastrointestinal cancer risk in Caucasians, polymerase chain reaction-RFLP with BsrI digestion and DHPLC set up at 59 degrees C are reliable and cost-effective methods to genotype UMPS.
20665215 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20647710 orotate phosphoribosyl transferase/DPD ratio has a relation to cancer staging and survival rate.
20647221 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20527751 novel phosphoribosyltransferase transition states
20453000 Observational study of gene-disease association. (HuGE Navigator)
20112501 Increased orotate phosphoribosyltransferase expression is associated with bladder cancers.
19724871 patients who developed distant recurrence of rectal cancer were found to have significantly higher intratumoral thymidylate synthase (TS), dihydropyrimidine dehydrogenase (DPD) and orotate phosphoribosyl transferase (OPRT)
19562503 [review] It is confirmed that the type I defect in hereditary orotic aciduria is caused by loss of uridine monophosphate (UMP)synthase activity
19332728 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19307741 High orotate phosphoribosyltransferase gene expression is associated with complete response to chemoradiotherapy in patients with squamous cell carcinoma of the esophagus
19082440 Immunohistochemical staining for Orotate phosphoribosyl transferase (OPRT)revealed strong expression of OPRT in prostate cancer cells. There was a significant correlation between OPRT mRNA expression levels and the tumor pathological grade
19074750 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19020767 head & neck, gastric, colorectal, breast, lung & pancreatic cancer were examined; findings show mRNA expression & protein level of thymidylate synthase, dihydropyrimidine dehydrogenase & orotate phosphoribosyltransferase differed according to cancer type
19020740 decreased activity of OPRT plays an important role in the acquired resistance of gastric cancer cells towards 5-FU
18949394 orotate phosphoribosyltransferase is involved in the invasion and metastasis of colorectal carcinoma
18854154 Knockdown of uridine monophosphate synthetase (UMPS) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18633253 determination of OPRT levels in gastric carcinoma tissue enables to predict the response to S-1-based neoadjuvant/adjuvant chemotherapy
18597678 OPRT activity levels in tumor tissue may be prognostic factor for survival in colorectal carcinoma with radical resection and 5-FU chemotherapy;postoperative survival was significantly better in patients with high OPRT activity
17854773 decreased the sensitivities of the cultured tumor cells to 5-FU. These results suggest that the OPRT expression level in tumors is an additional determinant of the efficacy of 5-FU.
17607371 data suggest that OPRT is involved in early events of pancreatic and gallbladder carcinogenesis and invasion of hepatocellular carcinomas
17549346 High expression of OPRT is associated with the response to adjuvant chemotherapy in human pancreatic cancer
17237621 Overexpression of the OPRT gene plays an important role in the antiproliferative effect of 5-FU.
16818689 The OPRT Gly213Ala polymorphism seems to be a useful marker for predicting toxicity to bolus 5-FU chemotherapy.
16328050 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16328050 The investigated SNPs of OPRT may have no major influence on 5-FU sensitivity.
16142362 orotate phosphoribosyl transferase has a role in lymph node metastasis of gastric cancer
15999119 thymidylate synthase and orotate phosphoribosyl transferase, but not dihydropyrimidine dehydrogenase, are more highly expressed in prostate cancer than in benign prostatic hyperplasia
14562021 expression of OPRT gene and the OPRT/dihydropyrimidine dehydrogenase ratio might be useful as predictive parameters for the efficacy of fluoropyrimidine-based chemotherapy for metastatic colorectal cancer

AA Sequence

MAVARAALGPLVTGLYDVQAFKFGDFVLKSGLSSPIYIDLRGIVSRPRLLSQVADILFQTAQNAGISFDT      1 - 70
VCGVPYTALPLATVICSTNQIPMLIRRKETKDYGTKRLVEGTINPGETCLIIEDVVTSGSSVLETVEVLQ     71 - 140
KEGLKVTDAIVLLDREQGGKDKLQAHGIRLHSVCTLSKMLEILEQQKKVDAETVGRVKRFIQENVFVAAN    141 - 210
HNGSPLSIKEAPKELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICML    211 - 280
KTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGV    281 - 350
VKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQ    351 - 420
LEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLGV              421 - 480
//

Text Mined References (55)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24158442 2013 Transition state analogues of Plasmodium falciparum and human orotate phosphoribosyltransferases.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22931617 2012 [Expressions of orotate phosphoribosyltransferase in colorectal carcinoma and its correlations with toxicities of chemotherapy].
22641663 2012 Expression of dihydropyrimidine dehydrogenase, orotate phosphoribosyl transferase and thymidylate synthase in patients with primary colorectal cancer, and associations with site of first metastasis.
22249354 2013 Novel mRNA isoforms and mutations of uridine monophosphate synthetase and 5-fluorouracil resistance in colorectal cancer.
21631301 2011 Frequency of uridine monophosphate synthase Gly(213)Ala polymorphism in Caucasian gastrointestinal cancer patients and healthy subjects, investigated by means of new, rapid genotyping assays.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20665215 2010 Value of gene polymorphisms as markers of 5-FU therapy response in stage III colon carcinoma: a pilot study.
20647710 2010 [Correlation between clinicopathological factors and enzymatic activity of orotate phosphoribosyl transferase (OPRT), dihydropyrimidine dehydrogenase (DPD) in esophageal cancer].
20647221 2011 Associations of various gene polymorphisms with toxicity in colorectal cancer patients receiving oral uracil and tegafur plus leucovorin: a prospective study.
20527751 2010 Pyrophosphate interactions at the transition states of Plasmodium falciparum and human orotate phosphoribosyltransferases.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20112501 2009 Expression of the fluoropyrimidine-metabolizing enzymes in bladder cancers as measured by the Danenberg tumor profile.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19724871 2009 Microdissection is essential for gene expression analysis of irradiated rectal cancer tissues.
19562503 2009 Orotic aciduria and uridine monophosphate synthase: a reappraisal.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19332728 2009 Pharmacogenetic analyses of a phase III trial in metastatic gastroesophageal adenocarcinoma with fluorouracil and leucovorin plus either oxaliplatin or cisplatin: a study of the arbeitsgemeinschaft internistische onkologie.
19307741 2009 High orotate phosphoribosyltransferase gene expression predicts complete response to chemoradiotherapy in patients with squamous cell carcinoma of the esophagus.
19082440 2009 Overexpression of orotate phosphoribosyl transferase in hormone-refractory prostate cancer.
19074750 2009 Pharmacogenetic analyses of hematotoxicity in advanced gastric cancer patients receiving biweekly fluorouracil, leucovorin, oxaliplatin and docetaxel (FLOT): a translational study of the Arbeitsgemeinschaft Internistische Onkologie (AIO).
19020767 2008 Thymidylate synthase, dihydropyrimidine dehydrogenase, orotate phosphoribosyltransferase mRNA and protein expression levels in solid tumors in large scale population analysis.
19020740 2008 Decreased orotate phosphoribosyltransferase activity produces 5-fluorouracil resistance in a human gastric cancer cell line.
18949394 2008 Expression of orotate phosphoribosyltransferase in colorectal carcinoma: an immunohistochemical analysis in several components of neoplastic lesions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18633253 2008 [Predictive value of orotate phosphoribosyltransferase in chemoresistant patients with gastric carcinoma who underwent S-1-based neoadjuvant/adjuvant chemotherapy].
18597678 2008 Clinical implications of thymidylate synthetase, dihydropyrimidine dehydrogenase and orotate phosphoribosyl transferase activity levels in colorectal carcinoma following radical resection and administration of adjuvant 5-FU chemotherapy.
18184586 2008 Structures of the human orotidine-5'-monophosphate decarboxylase support a covalent mechanism and provide a framework for drug design.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17854773 2007 Orotate phosphoribosyltransferase expression level in tumors is a potential determinant of the efficacy of 5-fluorouracil.
17607371 2007 Expression of orotate phosphoribosyltransferase (OPRT) in hepatobiliary and pancreatic carcinoma.
17549346 2007 Expression of orotate phosphoribosyl transferase in human pancreatic cancer: implication for the efficacy of uracil and tegafur-based adjuvant chemotherapy.
17505114 2007 Pseudo-merohedral twinning in monoclinic crystals of human orotidine-5'-monophosphate decarboxylase.
17237621 2006 Overexpression of the orotate phosphoribosyl-transferase gene enhances the effect of 5-fluorouracil on gastric cancer cell lines.
16818689 2006 Orotate phosphoribosyltransferase gene polymorphism predicts toxicity in patients treated with bolus 5-fluorouracil regimen.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16328050 2006 The relationship between 5-fluorouracil sensitivity and single nucleotide polymorphisms of the orotate phosphoribosyl transferase gene in colorectal cancer.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16142362 2005 Impact of orotate phosphoribosyl transferase activity as a predictor of lymph node metastasis in gastric cancer.
15999119 2005 Expression of thymidylate synthase, dihydropyrimidine dehydrogenase, thymidine phosphorylase, and orotate phosphoribosyl transferase in prostate cancer.
15890648 2005 Nuclear localization and mitogen-activated protein kinase phosphorylation of the multifunctional protein CAD.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14562021 2003 Both gene expression for orotate phosphoribosyltransferase and its ratio to dihydropyrimidine dehydrogenase influence outcome following fluoropyrimidine-based chemotherapy for metastatic colorectal cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11730338 2001 A nonradioactive high-performance liquid chromatographic microassay for uridine 5'-monophosphate synthase, orotate phosphoribosyltransferase, and orotidine 5'-monophosphate decarboxylase.
9042911 1997 Molecular cloning of the human UMP synthase gene and characterization of point mutations in two hereditary orotic aciduria families.
8069469 1994 Localization of uridine monophosphate synthase (UMPS) gene to river buffalo chromosomes by FISH.
6893554 1980 Isolation and initial characterization of the single polypeptide that synthesizes uridine 5'-monophosphate from orotate in Ehrlich ascites carcinoma. Purification by tandem affinity chromatography of uridine-5'-monophosphate synthase.
6574608 1983 Structural gene coding for multifunctional protein carrying orotate phosphoribosyltransferase and OMP decarboxylase activity is located on long arm of human chromosome 3.
3279416 1988 Molecular cloning and nucleotide sequence for the complete coding region of human UMP synthase.
2767686 1989 Localization of the gene for uridine monophosphate synthase to human chromosome region 3q13 by in situ hybridization.
2624233 1989 Molecular cloning of human UMP synthase.