Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 4.2e-09
diabetes mellitus 1728 2.9e-03

Synonym

Accession Q8N2C9
Symbols C21orf128

 Compartment GO Term (0)

AA Sequence

MAWGLPCHQNTAGANPHLFLGCYSTSSLQGLEYGGQRGDAHGKPGVLHGELEPHDHTSRLERHDLHSQLP      1 - 70
TSVQVRHHWWEGALDLAKKRQQQTSINVFTTIKQGSRCDRWMVLGAISLLYNQEEAPDDRPLRARREVRS     71 - 140
QHLSWAFPGTAGPGLVCAGDSQ                                                    141 - 162
//

Text Mined References (4)

PMID Year Title