Property Summary

NCBI Gene PubMed Count 23
PubMed Score 21.49
PubTator Score 3.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Alopecia areata 37 4.397 2.2
Disease Target Count Z-score Confidence
Telogen effluvium 4 3.826 1.9

Expression

Gene RIF (17)

PMID Text
25995251 Varicella-Zoster Virus differentially modulates expression of the NKG2D ligands by upregulating MICA expression and reducing ULBP2 and ULBP3 expression in the infected cells.
24677544 This study provides for the first time, the c-Myc dependent regulation of NKG2D ligands, ULBP1/2/3 in acute myeloid leukemia.
21934670 HIV-1-Vpr induced upregulation of NKG2D ligands in HIV-infected T cells by activating UNG2-dependent repair of uridine-containing DNA
21874023 HIV-1-Vpr induced upregulation of NKG2D ligands in HIV-infected T cells by activating UNG2-dependent repair of uridine-containing DNA
21689246 A greater expression of ULBP3 has also been found in hair follicles in scalp biopsy specimens from patients with active disease
21320692 A miRNA of the human JC and BK polyoma viruses targets the stress-induced ligand ULBP3 to escape immune elimination.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20596022 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20530255 Data show that UL142 prevents ULBP3 trafficking to the surface and protects transfected cells from NK-mediated cytotoxicity.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20219610 genetic polymorphism among the ethnic groups
20219610 Observational study of genotype prevalence. (HuGE Navigator)
19798433 Vpr specifically induces surface expression of the unique-long 16 binding proteins (ULBP)-1 and ULBP-2, but not ULBP-3
19688209 Observational study of genotype prevalence. (HuGE Navigator)
18394338 As NKG2D ligand, ULBP3 are expressed on immature and mature dendritic cells and plays an important role in the cytotoxic effect of NK cells against iDC.
15051759 ULBPs and MICA are expressed in lipid rafts at the cell surface of NK and T cells.
11777960 ULBP3 binds to the NGK2D receptor and activates multiple signaling pathways in primary natural killer cells.

AA Sequence

MAAAASPAILPRLAILPYLLFDWSGTGRADAHSLWYNFTIIHLPRHGQQWCEVQSQVDQKNFLSYDCGSD      1 - 70
KVLSMGHLEEQLYATDAWGKQLEMLREVGQRLRLELADTELEDFTPSGPLTLQVRMSCECEADGYIRGSW     71 - 140
QFSFDGRKFLLFDSNNRKWTVVHAGARRMKEKWEKDSGLTTFFKMVSMRDCKSWLRDFLMHRKKRLEPTA    141 - 210
PPTMAPGLAQPKAIATTLSPWSFLIILCFILPGI                                        211 - 244
//

Text Mined References (27)

PMID Year Title
25995251 2015 Varicella-Zoster Virus and Herpes Simplex Virus 1 Differentially Modulate NKG2D Ligand Expression during Productive Infection.
25980678 2015 Transfer of the human NKG2D ligands UL16 binding proteins (ULBP) 1-3 is related to lytic granule release and leads to ligand retransfer and killing of ULBP-recipient natural killer cells.
25138242 2014 The regulatory effect of UL-16 binding protein-3 expression on the cytotoxicity of NK cells in cancer patients.
24677544 2014 c-Myc regulates expression of NKG2D ligands ULBP1/2/3 in AML and modulates their susceptibility to NK-mediated lysis.
23319000 2014 Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21689246 Treatment of alopecia areata: "What is new on the horizon?".
21320692 2011 An identical miRNA of the human JC and BK polyoma viruses targets the stress-induced ligand ULBP3 to escape immune elimination.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20596022 2010 Genome-wide association study in alopecia areata implicates both innate and adaptive immunity.
20530255 2010 Intracellular sequestration of the NKG2D ligand ULBP3 by human cytomegalovirus.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20219610 2010 Single nucleotide polymorphism analysis of the NKG2D ligand cluster on the long arm of chromosome 6: Extensive polymorphisms and evidence of diversity between human populations.
19798433 2009 HIV-1 Vpr triggers natural killer cell-mediated lysis of infected cells through activation of the ATR-mediated DNA damage response.
19688209 2009 Polymorphisms of NKG2D ligands: diverse RAET1/ULBP genes in northeastern Thais.
18394338 2008 [Expression of NKG2D ligands on dendritic cells at different development stages and its effect on cytotoxicity of NK cells].
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15051759 2004 Cell surface organization of stress-inducible proteins ULBP and MICA that stimulate human NK cells and T cells via NKG2D.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12753652 2003 NKG2D ligands: unconventional MHC class I-like molecules exploited by viruses and cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11827464 2002 A cluster of ten novel MHC class I related genes on human chromosome 6q24.2-q25.3.
11777960 2002 UL16-binding proteins, novel MHC class I-related proteins, bind to NKG2D and activate multiple signaling pathways in primary NK cells.
11754823 2001 Conformational plasticity revealed by the cocrystal structure of NKG2D and its class I MHC-like ligand ULBP3.
11491531 Interactions of human NKG2D with its ligands MICA, MICB, and homologs of the mouse RAE-1 protein family.
11239445 2001 ULBPs, novel MHC class I-related molecules, bind to CMV glycoprotein UL16 and stimulate NK cytotoxicity through the NKG2D receptor.