Property Summary

NCBI Gene PubMed Count 48
PubMed Score 49.23
PubTator Score 40.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
malignant mesothelioma -2.900 3.7e-08
astrocytic glioma -1.400 4.2e-03
ependymoma -1.400 5.1e-03
oligodendroglioma -1.400 4.2e-03
esophageal adenocarcinoma -1.400 2.0e-02
psoriasis 3.300 2.3e-125
osteosarcoma 2.022 7.4e-03
cystic fibrosis 1.700 2.3e-05
atypical teratoid / rhabdoid tumor -1.300 7.5e-04
medulloblastoma, large-cell -1.900 8.2e-07
adrenocortical carcinoma 1.946 2.0e-03
tuberculosis -1.900 2.4e-04
non-small cell lung cancer 2.257 3.7e-11
intraductal papillary-mucinous carcinoma... 1.800 7.0e-03
intraductal papillary-mucinous neoplasm ... 3.500 4.9e-06
pancreatic cancer 1.700 2.0e-05
pilocytic astrocytoma -1.100 2.0e-04
Breast cancer 1.200 1.4e-02
ductal carcinoma in situ 1.200 4.6e-02

Gene RIF (50)

PMID Text
26805759 By suppressing AR and up-regulating ULBP2 in HCC, cisplatin could up-regulate cytotoxicity of NK cells to better target HCC.
25995251 Varicella-Zoster Virus differentially modulates expression of the NKG2D ligands by upregulating MICA expression and reducing ULBP2 and ULBP3 expression in the infected cells.
25983110 A conserved WW domain-like motif regulates CD74 antigen-dependent cell-surface transport of the NKG2D ligand ULBP2.
25807049 HIV-1 Vpr from most HIV-1 primary isolates can upregulate ULBP2 expression and induce NKG2D-dependent NK cell killing
25775242 This study suggests that NKG2D ligands shedding of MICA, MICB and ULBP-2 is a novel pathway in endometriosis complex pathogenesis that impairs Natural Killer Cells cell function.
25687758 Data inticate that heat shock protein 60 (HSP60) interacted constitutively with NKG2D ligand ULBP2 and phosphatase of regenerating liver 3 (PRL-3) regulated HSP60 tyrosine phosphorylation.
25634359 NKG2D and NKG2DL are involved in allergen-induced activation of dendritic epidermal T cells and the NKG2D/NKG2DL pathway might be a potential target for treatment of contact hypersensitivity.
25212604 Human anaplastic thyroid carcinoma cells are sensitive to NK cell-mediated lysis via ULBP2/5/6 and chemoattract NK cells.
25024379 the NKG2D ligand ULBP2 is transported to the cell surface through an endosomal pathway dependent on protein kinase C and lysosomal integrity. ULBP2 surface transport is dependent on the invariant chain.
24846123 c-Cbl regulates MICA- but not ULBP2-induced NKG2D down-modulation in human NK cells.
24841552 Results suggest that ULBP2 is expressed and released from cervical cancer cells by CRF, which regulates NKG2D expression in natural killer cells.
24677544 This study provides for the first time, the c-Myc dependent regulation of NKG2D ligands, ULBP1/2/3 in acute myeloid leukemia.
24614922 human tumor cells lost their surface expression of ULBP2, but not ULBP1 and ULBP3, during NK cell-mediated cytolysis.
24045107 HIV-1 Vpr from most HIV-1 primary isolates can upregulate ULBP2 expression and induce NKG2D-dependent NK cell killing
23726848 Vpr augments ULBP2 expression on both infected and uninfected bystander cells during HIV-1 infection of primary CD4+ T lymphocytes.
23726848 HIV-1 Vpr from most HIV-1 primary isolates can upregulate ULBP2 expression and induce NKG2D-dependent NK cell killing
23202519 HIV-1 Vpr from most HIV-1 primary isolates can upregulate ULBP2 expression and induce NKG2D-dependent NK cell killing
22274659 HIV-1 Vpr from most HIV-1 primary isolates can upregulate ULBP2 expression and induce NKG2D-dependent NK cell killing
22102694 Study shows that tumor-suppressive miR-34a and miR-34c act as ULBP2 repressors. Findings also implicate p53 in ULBP2 regulation, emphasizing the role of the specific NKG2DL in tumor immune surveillance.
21994772 HIV-1 Vpr from most HIV-1 primary isolates can upregulate ULBP2 expression and induce NKG2D-dependent NK cell killing
21957298 HIV-1 Vpr from most HIV-1 primary isolates can upregulate ULBP2 expression and induce NKG2D-dependent NK cell killing
21934670 HIV-1 Vpr from most HIV-1 primary isolates can upregulate ULBP2 expression and induce NKG2D-dependent NK cell killing
21874023 HIV-1 Vpr from most HIV-1 primary isolates can upregulate ULBP2 expression and induce NKG2D-dependent NK cell killing
21857986 Data show that VSV infection caused an active suppression of NKG2D-ligand surface expression, affecting both endogenous and histone deacetylase (HDAC)-inhibitor induced MICA, MICB and ULBP-2 expression.
21764762 Findings define the involvement of p53 in the regulation of ULBP1 and ULBP2 which enhance NK cell-mediated target recognition.
21625447 analysis of the area under receiver operating characteristic curves showed that ULBP2 was superior to CA 19-9 in discriminating patients with early-stage PC from healthy controls
21321117 Data show that IL-32alpha stimulates Fas and ULBP2 expression via activation of p38 MAPK, which increases NK susceptibility of chronic myeloid leukemia cells.
21224393 The human NKG2D ligand ULBP2 can be expressed at the cell surface with or without a GPI anchor and both forms can activate NK cells
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20428196 Levels of soluble ULBP2 were significantly increased in B-cell chronic lymphocytic leukemia.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20219610 Observational study of genotype prevalence. (HuGE Navigator)
20054857 it was shown that high expression of several NKG2D ligands is inversely correlated with ovarian cancer survival
20008788 HIV-1 Vpr from most HIV-1 primary isolates can upregulate ULBP2 expression and induce NKG2D-dependent NK cell killing
19798433 Vpr specifically induces surface expression of the unique-long 16 binding proteins (ULBP)-1 and ULBP-2, but not ULBP-3
19798433 HIV-1 Vpr from most HIV-1 primary isolates can upregulate ULBP2 expression and induce NKG2D-dependent NK cell killing
19688209 Observational study of genotype prevalence. (HuGE Navigator)
19671853 Only sULBP2 is an independent predictor of prognosis, the significance of which is superior to the well-established and widely used melanoma serum marker S100B.
19508374 Data show upon HSV-1 infection of cell lines, surface levels of NKG2D ligands MICA antigen and UL16 binding protein 2 were downmodulated due to late viral ICP0 gene product(s).
19449444 HIV-1 Vpr from most HIV-1 primary isolates can upregulate ULBP2 expression and induce NKG2D-dependent NK cell killing
19424970 RAET1G, like ULBP2, appears broadly expressed, but exhibits a lower apparent avidity for NKG2D due to a mutation in the center of the MHC-like fold.
19151770 administration of ATRA or sodium valproate to patients affected with acute myeloid leukaemia M3 or M1 respectively, leads to the induction of transcription and expression of NKG2D-L at the surface of leukaemic cells.
19089914 IFN-gamma, by down-regulating ligand expression, might facilitate escape of MHC class I-negative melanoma cells from NKG2D-mediated killing by NK cells.
18791713 ULBP2 was seen on 82.9% of ovarian cancer cells but not on normal ovarian epithelium. Strong expression of ULBP2 in these cells correlated with less intraepithelial infiltration of T cells & may relate to T cell dysfunction in the tumor microenvironment.
18706445 IL-18 treatment increased ULBP2 expression in leukemia cells at the mRNA and protein levels
17391757 These findings identify NKG2D ligands as targets of leukemia differentiation therapy
17170457 HIV-1 Vpr from most HIV-1 primary isolates can upregulate ULBP2 expression and induce NKG2D-dependent NK cell killing
15051759 ULBPs and MICA are expressed in lipid rafts at the cell surface of NK and T cells.
12847260 Human cytomegalovirus induces the expression of ULBP2, which is predominantly localized in the endoplasmic reticulum of infected fibroblasts together with viral protein UL16.
11777960 ULBP2 binds to the NKG2D receptor and activates multiple signaling pathways in primary natural killer cells.

AA Sequence

MAAAAATKILLCLPLLLLLSGWSRAGRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKT      1 - 70
VTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQ     71 - 140
FSFDGQIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAG    141 - 210
APLAMSSGTTQLRATATTLILCCLLIILPCFILPGI                                      211 - 246
//

Text Mined References (49)

PMID Year Title
26805759 2016 Cisplatin enhances NK cells immunotherapy efficacy to suppress HCC progression via altering the androgen receptor (AR)-ULBP2 signals.
26190895 2015 Effect of Clarithromycin on the Expression of UL16-Binding Protein 2 in Human Cells.
25995251 2015 Varicella-Zoster Virus and Herpes Simplex Virus 1 Differentially Modulate NKG2D Ligand Expression during Productive Infection.
25983110 2015 A conserved WW domain-like motif regulates invariant chain-dependent cell-surface transport of the NKG2D ligand ULBP2.
25775242 2015 Soluble ligands for the NKG2D receptor are released during endometriosis and correlate with disease severity.
25687758 2015 PRL-3 mediates the protein maturation of ULBP2 by regulating the tyrosine phosphorylation of HSP60.
25634359 2015 NKG2D-dependent activation of dendritic epidermal T cells in contact hypersensitivity.
25212604 2014 Human anaplastic thyroid carcinoma cells are sensitive to NK cell-mediated lysis via ULBP2/5/6 and chemoattract NK cells.
25024379 2014 The NKG2D ligand ULBP2 is specifically regulated through an invariant chain-dependent endosomal pathway.
24846123 2014 c-Cbl regulates MICA- but not ULBP2-induced NKG2D down-modulation in human NK cells.
24841552 2014 Corticotropin-releasing factor induces immune escape of cervical cancer cells by downregulation of NKG2D.
24677544 2014 c-Myc regulates expression of NKG2D ligands ULBP1/2/3 in AML and modulates their susceptibility to NK-mediated lysis.
24614922 2014 Natural killer cell-mediated shedding of ULBP2.
23726848 2013 Viral protein R upregulates expression of ULBP2 on uninfected bystander cells during HIV-1 infection of primary CD4+ T lymphocytes.
22102694 2012 Tumor suppressive microRNAs miR-34a/c control cancer cell expression of ULBP2, a stress-induced ligand of the natural killer cell receptor NKG2D.
21857986 2011 Vesicular stomatitis virus infection promotes immune evasion by preventing NKG2D-ligand surface expression.
21764762 2011 Human NK cells are alerted to induction of p53 in cancer cells by upregulation of the NKG2D ligands ULBP1 and ULBP2.
21625447 2011 Secretome-based identification of ULBP2 as a novel serum marker for pancreatic cancer detection.
21321117 2011 Overexpression of IL-32alpha increases natural killer cell-mediated killing through up-regulation of Fas and UL16-binding protein 2 (ULBP2) expression in human chronic myeloid leukemia cells.
21224393 2011 The human NKG2D ligand ULBP2 can be expressed at the cell surface with or without a GPI anchor and both forms can activate NK cells.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20428196 2010 The prognostic significance of soluble NKG2D ligands in B-cell chronic lymphocytic leukemia.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20219610 2010 Single nucleotide polymorphism analysis of the NKG2D ligand cluster on the long arm of chromosome 6: Extensive polymorphisms and evidence of diversity between human populations.
20054857 2010 ULBP2 and RAET1E NKG2D ligands are independent predictors of poor prognosis in ovarian cancer patients.
19798433 2009 HIV-1 Vpr triggers natural killer cell-mediated lysis of infected cells through activation of the ATR-mediated DNA damage response.
19688209 2009 Polymorphisms of NKG2D ligands: diverse RAET1/ULBP genes in northeastern Thais.
19671853 2009 Differential clinical significance of individual NKG2D ligands in melanoma: soluble ULBP2 as an indicator of poor prognosis superior to S100B.
19508374 2009 Herpes simplex virus infection downmodulates NKG2D ligand expression.
19424970 2009 Differential NKG2D binding to highly related human NKG2D ligands ULBP2 and RAET1G is determined by a single amino acid in the alpha2 domain.
19151770 2009 Effective in vivo induction of NKG2D ligands in acute myeloid leukaemias by all-trans-retinoic acid or sodium valproate.
19089914 2009 Interferon-gamma down-regulates NKG2D ligand expression and impairs the NKG2D-mediated cytolysis of MHC class I-deficient melanoma by natural killer cells.
18791713 2009 Clinical significance of the NKG2D ligands, MICA/B and ULBP2 in ovarian cancer: high expression of ULBP2 is an indicator of poor prognosis.
18706445 2008 IL-18 enhances ULBP2 expression through the MAPK pathway in leukemia cells.
18676862 2008 Tumor-associated MICA is shed by ADAM proteases.
17391757 2007 Differentiation-promoting drugs up-regulate NKG2D ligand expression and enhance the susceptibility of acute myeloid leukemia cells to natural killer cell-mediated lysis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15051759 2004 Cell surface organization of stress-inducible proteins ULBP and MICA that stimulate human NK cells and T cells via NKG2D.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12847260 2003 Effects of human cytomegalovirus infection on ligands for the activating NKG2D receptor of NK cells: up-regulation of UL16-binding protein (ULBP)1 and ULBP2 is counteracted by the viral UL16 protein.
12782710 2003 Human cytomegalovirus glycoprotein UL16 causes intracellular sequestration of NKG2D ligands, protecting against natural killer cell cytotoxicity.
12753652 2003 NKG2D ligands: unconventional MHC class I-like molecules exploited by viruses and cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11827464 2002 A cluster of ten novel MHC class I related genes on human chromosome 6q24.2-q25.3.
11777960 2002 UL16-binding proteins, novel MHC class I-related proteins, bind to NKG2D and activate multiple signaling pathways in primary NK cells.
11491531 Interactions of human NKG2D with its ligands MICA, MICB, and homologs of the mouse RAE-1 protein family.
11444831 2001 A novel secreted tumor antigen with a glycosylphosphatidylinositol-anchored structure ubiquitously expressed in human cancers.
11239445 2001 ULBPs, novel MHC class I-related molecules, bind to CMV glycoprotein UL16 and stimulate NK cytotoxicity through the NKG2D receptor.