Property Summary

NCBI Gene PubMed Count 34
PubMed Score 46.04
PubTator Score 36.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 1.2e-18
Disease Target Count Z-score Confidence
Cancer 2346 3.431 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.100 1.2e-18

Gene RIF (29)

PMID Text
26565589 ATF4 drives ULBP1 gene expression in cancer cell lines, while the RNA-binding protein RBM4 supports ULBP1 expression by suppressing a novel alternatively spliced isoform of ULBP1 mRNA.
24911793 expression determines intrinsic acute myeloid leukemia susceptibility to allogeneic V[gamma]9V[delta]2 T cells
24677544 This study provides for the first time, the c-Myc dependent regulation of NKG2D ligands, ULBP1/2/3 in acute myeloid leukemia.
22720156 HIV-1-Vpr induced upregulation of NKG2D ligands in HIV-infected T cells by activating UNG2-dependent repair of uridine-containing DNA
22274659 HIV-1-Vpr induced upregulation of NKG2D ligands in HIV-infected T cells by activating UNG2-dependent repair of uridine-containing DNA
21994772 HIV-1-Vpr induced upregulation of NKG2D ligands in HIV-infected T cells by activating UNG2-dependent repair of uridine-containing DNA
21934670 HIV-1-Vpr induced upregulation of NKG2D ligands in HIV-infected T cells by activating UNG2-dependent repair of uridine-containing DNA
21874023 HIV-1-Vpr induced upregulation of NKG2D ligands in HIV-infected T cells by activating UNG2-dependent repair of uridine-containing DNA
21764762 Findings define the involvement of p53 in the regulation of ULBP1 and ULBP2 which enhance NK cell-mediated target recognition.
21756848 recurrence-free survival of patients with ULBP1-negative hepatocellular carcinoma (HCC) was significantly shorter than that of patients with ULBP1-positive HCC
21464092 recombinant ULBP1 fused to CD45 caused a reduction in cytotoxicity and degranulation by NK cells, implying a role for receptor ligand distribution in the activation of NK cell responses
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20870941 These results identify Mult1 as a target for the MARCH family of E3 ligases
20237496 Observational study of gene-disease association. (HuGE Navigator)
20220060 Data show that ULBP1, TFR2 and IFITM1 were associated with increased susceptibility to Vgamma9Vdelta2 T-cell cytotoxicity.
20219610 Observational study of genotype prevalence. (HuGE Navigator)
20008788 HIV-1-Vpr induced upregulation of NKG2D ligands in HIV-infected T cells by activating UNG2-dependent repair of uridine-containing DNA
19798433 Vpr specifically induces surface expression of the unique-long 16 binding proteins (ULBP)-1 and ULBP-2, but not ULBP-3
19798433 HIV-1-Vpr induced upregulation of NKG2D ligands in HIV-infected T cells by activating UNG2-dependent repair of uridine-containing DNA
19688209 Observational study of genotype prevalence. (HuGE Navigator)
19500498 Data show that the protease NS3/4A of HCV down-regulates ULBP1 expression by inhibiting the transcription of ULBP1.
19449444 HIV-1-Vpr induced upregulation of NKG2D ligands in HIV-infected T cells by activating UNG2-dependent repair of uridine-containing DNA
19414815 The selective induction of ULBP1 expression by proteasome inhibitor drugs, along with variable NKG2D ligand expression by human tumor cells, indicates that NKG2D ligand genes are independently regulated.
18394338 As NKG2D ligand, ULBP1 are expressed on immature dendritic cells and plays an important role in the cytotoxic effect of NK cells against iDC.
17170457 HIV-1-Vpr induced upregulation of NKG2D ligands in HIV-infected T cells by activating UNG2-dependent repair of uridine-containing DNA
16901903 ULBP1 is a human ligand of the NKG2D receptor
15051759 ULBPs and MICA are expressed in lipid rafts at the cell surface of NK and T cells.
12847260 The NKG2D ligand ULBP1 is up-regulated and readily detectable intracellularly in the endoplasmic reticulum of human cytomegalovirus-infected fibroblasts, where it colocalizes with viral protein UL16.
11777960 ULBP1 binds to the NKG2D receptor and activates multiple signaling pathways in primary natural killer cells.

AA Sequence

MAAAASPAFLLCLPLLHLLSGWSRAGWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHK      1 - 70
AKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQ     71 - 140
FLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKP    141 - 210
PSLAPGTTQPKAMATTLSPWSLLIIFLCFILAGR                                        211 - 244
//

Text Mined References (36)

PMID Year Title
26565589 2015 A forward genetic screen reveals novel independent regulators of ULBP1, an activating ligand for natural killer cells.
25510288 2014 MICA/B and ULBP1 NKG2D ligands are independent predictors of good prognosis in cervical cancer.
25473094 2015 Immunohistochemical validation and expression profiling of NKG2D ligands in a wide spectrum of human epithelial neoplasms.
25393931 Methylation of NKG2D ligands contributes to immune system evasion in acute myeloid leukemia.
25218028 2015 COX-2- and endoplasmic reticulum stress-independent induction of ULBP-1 and enhancement of sensitivity to NK cell-mediated cytotoxicity by celecoxib in colon cancer cells.
25136121 2014 Immune evasion mediated by tumor-derived lactate dehydrogenase induction of NKG2D ligands on myeloid cells in glioblastoma patients.
24911793 A comprehensive analysis of primary acute myeloid leukemia identifies biomarkers predicting susceptibility to human allogeneic V?9V?2 T cells.
24677544 2014 c-Myc regulates expression of NKG2D ligands ULBP1/2/3 in AML and modulates their susceptibility to NK-mediated lysis.
21764762 2011 Human NK cells are alerted to induction of p53 in cancer cells by upregulation of the NKG2D ligands ULBP1 and ULBP2.
21756848 2012 Reduced NKG2D ligand expression in hepatocellular carcinoma correlates with early recurrence.
21464092 2011 Cutting edge: NKG2D-dependent cytotoxicity is controlled by ligand distribution in the target cell membrane.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20923822 2010 Radiation pharmacogenomics: a genome-wide association approach to identify radiation response biomarkers using human lymphoblastoid cell lines.
20870941 2010 Stress-regulated targeting of the NKG2D ligand Mult1 by a membrane-associated RING-CH family E3 ligase.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20220060 2010 Identification of a panel of ten cell surface protein antigens associated with immunotargeting of leukemias and lymphomas by peripheral blood gammadelta T cells.
20219610 2010 Single nucleotide polymorphism analysis of the NKG2D ligand cluster on the long arm of chromosome 6: Extensive polymorphisms and evidence of diversity between human populations.
19798433 2009 HIV-1 Vpr triggers natural killer cell-mediated lysis of infected cells through activation of the ATR-mediated DNA damage response.
19688209 2009 Polymorphisms of NKG2D ligands: diverse RAET1/ULBP genes in northeastern Thais.
19500498 2009 [The construction of reporter plasmid of ULBP1 and preliminary studying on the influence of NS3/4A on transcription of ULBP1].
19414815 2009 Proteasome regulation of ULBP1 transcription.
18394338 2008 [Expression of NKG2D ligands on dendritic cells at different development stages and its effect on cytotoxicity of NK cells].
16901903 2006 Transcriptional regulation of ULBP1, a human ligand of the NKG2D receptor.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15240696 2004 Two human ULBP/RAET1 molecules with transmembrane regions are ligands for NKG2D.
15051759 2004 Cell surface organization of stress-inducible proteins ULBP and MICA that stimulate human NK cells and T cells via NKG2D.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12847260 2003 Effects of human cytomegalovirus infection on ligands for the activating NKG2D receptor of NK cells: up-regulation of UL16-binding protein (ULBP)1 and ULBP2 is counteracted by the viral UL16 protein.
12782710 2003 Human cytomegalovirus glycoprotein UL16 causes intracellular sequestration of NKG2D ligands, protecting against natural killer cell cytotoxicity.
12753652 2003 NKG2D ligands: unconventional MHC class I-like molecules exploited by viruses and cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11827464 2002 A cluster of ten novel MHC class I related genes on human chromosome 6q24.2-q25.3.
11777960 2002 UL16-binding proteins, novel MHC class I-related proteins, bind to NKG2D and activate multiple signaling pathways in primary NK cells.
11491531 Interactions of human NKG2D with its ligands MICA, MICB, and homologs of the mouse RAE-1 protein family.
11239445 2001 ULBPs, novel MHC class I-related molecules, bind to CMV glycoprotein UL16 and stimulate NK cytotoxicity through the NKG2D receptor.