Property Summary

NCBI Gene PubMed Count 55
PubMed Score 49.68
PubTator Score 48.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Menopause present (finding) 20
Disease Target Count P-value
ovarian cancer 8491 8.1e-08
group 3 medulloblastoma 2254 1.8e-03
Disease Target Count Z-score Confidence
Breast cancer 3098 3.491 1.7
Fanconi's anemia 50 3.36 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma 1.100 1.8e-03
ovarian cancer -1.300 8.1e-08

Protein-protein Interaction (5)

Gene RIF (40)

PMID Text
26781088 TRAIP/RNF206 is required for recruitment of RAP80 to sites of DNA damage.(
26748910 RAP80 is a critical gatekeeper in impeding epithelial-mesenchymal transition-induced metastasis and malignant phenotypes of cancer as well as preserving DNA integrity.
26719330 Data suggest that RAP80 SIM (SUMO interacting motif) binds SUMO-2; both specificity and affinity are enhanced through phosphorylation of canonical CK2 (casein kinase 2) site within the SIM.
26446986 Impaired TIP60-mediated H4K16 acetylation accounts for the aberrant chromatin accumulation of 53BP1 and RAP80 in Fanconi anemia pathway-deficient cells.
25164908 patients with low RAP80 expression received gemcitabine/cisplatin, those with intermediate/high RAP80 expression and low/intermediate BRCA1 expression received docetaxel/cisplatin
25132264 A new role of FANCG in Homologous recombination repair of interstrand crosslinks through K63Ub-mediated interaction with the Rap80-BRCA1 complex.
24627472 Data indicate that a single point deletion (DeltaE81) in RAP80 abrogates multivalent interactions with polyubiquitin.
23264621 post-translational phosphorylation of RAP80 by the Cdk1-cyclin B(1) complex is important for RAP80 functional sensitivity to IR and G(2)/M checkpoint control.
23211528 connect ubiquitin- and SUMO-dependent DSB recognition, revealing that RNF4-synthesized hybrid SUMO-ubiquitin chains are recognized by RAP80 to promote BRCA1 recruitment and DNA repair.
22792303 Loss of RAP80 abolishes the recruitment of the BRCA1-A complex to DNA lesions in response to DNA damage.
22742833 We show that RNF168, its paralog RNF169, RAD18, and the BRCA1-interacting RAP80 protein accumulate at DNA double strand break sites through the use of bipartite modules composed of ubiquitin binding domains.
22689573 a model in which SUMO and Ub modification is coordinated to recruit Rap80 and BRCA1 to DNA damage sites.
22426463 APC/C(Cdc20) or APC/C(Cdh1) complexes regulate RAP80 stability during mitosis to the G(1) phase, and these events are critical for a novel function of RAP80 in mitotic progression.
21857162 MDC1 is required for the recruitment of RAP80 to DNA double-strand breaks.
21622030 The interaction between MDC1 and RAP80 requires the tandem BRCT domain of MDC1 and the ubiquitin-interacting motifs of RAP80
21406551 RAP80/BRCA1 complexes suppress excessive double-strand break end processing, HR-type double-strand break repair, and overt chromosomal instability
21335604 a model in which the BRCA1-RAP80 complex limits nuclease accessibility to DSBs, thus preventing excessive end resection and potentially deleterious homology-directed DSB repair mechanisms that can impair genome integrity.
19448621 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19433585 Data show that it can function in an autoregulatory loop consisting of RAP80, HDM2, and the p53 master regulatory network, implpying an important role for this loop in genome stability and oncogenesis.
19415121 RAP80 was a significant factor for survival in patients treated according to BRCA1 levels
19328070 findings show how the sequence between the Rap80 ubiquitin interacting motifs positions the domains for efficient avid polyubiquitin binding across a single K63 linkage, thus defining selectivity
19305427 critical constitutional mutations in RAP80 abrogate DNA damage responses (DDR) function and may be involved in genetic predisposition to cancer.
19261746 MERIT40 represents a novel factor that links BRCA1-Rap80 complex integrity, DSB recognition, and ubiquitin chain hydrolytic activities to the DNA damage response.
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18695986 it seems unlikely that moderate to highly penetrant alleles of either RAP80 or Abraxas, confer a significantly high relative risk of breast cancer.
18695986 Observational study of gene-disease association. (HuGE Navigator)
18550271 Depletion of RAP80 or RNF8 impairs the translocation of BRCA1 to DNA damage sites and results in defective cell cycle checkpoint control and DSB repair
18519686 UV irradiation induces translocation of RAP80 to DNA damage foci that colocalize with gamma-H2AX
18306035 Truncating mutations of the RAP80 gene do not seem to be a cause of familial breast cancer. A novel RAP80 haplotype or rare missense mutations (p.Ala342Thr, p.Met353Thr and p.Tyr575Asp) may be associated with a modest increased risk of breast cancer.
18306035 Observational study of gene-disease association. (HuGE Navigator)
18270812 Mutational analysis in 168 multiple-case breast/ovarian cancer families, negative for mutations in BRCA1 or BRCA2, suggests that RAP80 does not play an important role as a high penetrance breast cancer susceptibility gene.
18270812 Observational study of gene-disease association. (HuGE Navigator)
18077395 the human Ubc13/Rnf8 ubiquitin ligases control foci formation of the Rap80/Abraxas/Brca1/Brcc36 complex in response to DNA damage
17698038 RAP80 interacts with the SUMO-conjugating enzyme UBC9 and is a novel target for sumoylation
17621610 the ubiquitin-interacting motif containing protein RAP80 interacts with BRCA1 and functions in DNA damage repair response
17562356 RAP80/UIMC1, the protein highly expressed in testis, was identified as a new cancer-associated antigen.
17525342 identification of receptor-associated protein 80 (RAP80) as a BRCA1-interacting protein in humans
17525341 data support a model wherein ubiquitin chains at DNA damage sites are used as a targeting mechanism by specific BRCA1 complexes; RAP80 may represent a new class of DNA repair proteins that uses tandem UIM domains as part of its recruitment to DSBs
17525340 Abraxas and RAP80 were required for DNA damage resistance, G(2)-M checkpoint control, and DNA repair.
12080054 a novel nuclear protein that interacts with the retinoid-related testis-associated receptor

AA Sequence

MPRRKKKVKEVSESRNLEKKDVETTSSVSVKRKRRLEDAFIVISDSDGEEPKEENGLQKTKTKQSNRAKC      1 - 70
LAKRKIAQMTEEEQFALALKMSEQEAREVNSQEEEEEELLRKAIAESLNSCRPSDASATRSRPLATGPSS     71 - 140
QSHQEKTTDSGLTEGIWQLVPPSLFKGSHISQGNEAEEREEPWDHTEKTEEEPVSGSSGSWDQSSQPVFE    141 - 210
NVNVKSFDRCTGHSAEHTQCGKPQESTGRGSAFLKAVQGSGDTSRHCLPTLADAKGLQDTGGTVNYFWGI    211 - 280
PFCPDGVDPNQYTKVILCQLEVYQKSLKMAQRQLLNKKGFGEPVLPRPPSLIQNECGQGEQASEKNECIS    281 - 350
EDMGDEDKEERQESRASDWHSKTKDFQESSIKSLKEKLLLEEEPTTSHGQSSQGIVEETSEEGNSVPASQ    351 - 420
SVAALTSKRSLVLMPESSAEEITVCPETQLSSSETFDLEREVSPGSRDILDGVRIIMADKEVGNKEDAEK    421 - 490
EVAISTFSSSNQVSCPLCDQCFPPTKIERHAMYCNGLMEEDTVLTRRQKEAKTKSDSGTAAQTSLDIDKN    491 - 560
EKCYLCKSLVPFREYQCHVDSCLQLAKADQGDGPEGSGRACSTVEGKWQQRLKNPKEKGHSEGRLLSFLE    561 - 630
QSEHKTSDADIKSSETGAFRVPSPGMEEAGCSREMQSSFTRRDLNESPVKSFVSISEATDCLVDFKKQVT    631 - 700
VQPGSRTRTKAGRGRRRKF                                                       701 - 719
//

Text Mined References (68)

PMID Year Title
26781088 2016 TRAIP/RNF206 is required for recruitment of RAP80 to sites of DNA damage.
26748910 2016 RAP80 regulates epithelial-mesenchymal transition related with metastasis and malignancy of cancer.
26719330 2016 Molecular Basis for Phosphorylation-dependent SUMO Recognition by the DNA Repair Protein RAP80.
26446986 2016 Impaired TIP60-mediated H4K16 acetylation accounts for the aberrant chromatin accumulation of 53BP1 and RAP80 in Fanconi anemia pathway-deficient cells.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25164908 2014 Two biomarker-directed randomized trials in European and Chinese patients with nonsmall-cell lung cancer: the BRCA1-RAP80 Expression Customization (BREC) studies.
25132264 2015 K63-linked ubiquitination of FANCG is required for its association with the Rap80-BRCA1 complex to modulate homologous recombination repair of DNA interstand crosslinks.
24627472 2014 Molecular basis for impaired DNA damage response function associated with the RAP80 ?E81 defect.
24075985 2013 A BRISC-SHMT complex deubiquitinates IFNAR1 and regulates interferon responses.
23708797 2013 Ubiquitin-dependent recruitment of the Bloom syndrome helicase upon replication stress is required to suppress homologous recombination.
23264621 2013 Cdk1 protein-mediated phosphorylation of receptor-associated protein 80 (RAP80) serine 677 modulates DNA damage-induced G2/M checkpoint and cell survival.
23211528 2012 RNF4-dependent hybrid SUMO-ubiquitin chains are signals for RAP80 and thereby mediate the recruitment of BRCA1 to sites of DNA damage.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22792303 2012 Loss of BRCA1-A complex function in RAP80 null tumor cells.
22742833 2012 Tandem protein interaction modules organize the ubiquitin-dependent response to DNA double-strand breaks.
22703881 2012 Genetic associations for activated partial thromboplastin time and prothrombin time, their gene expression profiles, and risk of coronary artery disease.
22689573 2012 Rap80 protein recruitment to DNA double-strand breaks requires binding to both small ubiquitin-like modifier (SUMO) and ubiquitin conjugates.
22426463 2012 Degradation of human RAP80 is cell cycle regulated by Cdc20 and Cdh1 ubiquitin ligases.
22267201 2012 Meta-analyses identify 13 loci associated with age at menopause and highlight DNA repair and immune pathways.
21857162 2011 Recruitment of proteins to DNA double-strand breaks: MDC1 directly recruits RAP80.
21622030 2011 MDC1 is ubiquitylated on its tandem BRCT domain and directly binds RAP80 in a UBC13-dependent manner.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21406551 2011 RAP80-directed tuning of BRCA1 homologous recombination function at ionizing radiation-induced nuclear foci.
21335604 2011 The BRCA1-RAP80 complex regulates DNA repair mechanism utilization by restricting end resection.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19615732 2009 Defining the human deubiquitinating enzyme interaction landscape.
19448621 2009 Genome-wide association studies identify loci associated with age at menarche and age at natural menopause.
19433585 2009 A regulatory loop composed of RAP80-HDM2-p53 provides RAP80-enhanced p53 degradation by HDM2 in response to DNA damage.
19415121 2009 Customized treatment in non-small-cell lung cancer based on EGFR mutations and BRCA1 mRNA expression.
19328070 2009 Linkage-specific avidity defines the lysine 63-linked polyubiquitin-binding preference of rap80.
19305427 2009 Familial breast cancer screening reveals an alteration in the RAP80 UIM domain that impairs DNA damage response function.
19261749 2009 NBA1, a new player in the Brca1 A complex, is required for DNA damage resistance and checkpoint control.
19261748 2009 MERIT40 facilitates BRCA1 localization and DNA damage repair.
19261746 2009 MERIT40 controls BRCA1-Rap80 complex integrity and recruitment to DNA double-strand breaks.
19202061 2009 The Rap80-BRCC36 de-ubiquitinating enzyme complex antagonizes RNF8-Ubc13-dependent ubiquitination events at DNA double strand breaks.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
19015238 2009 Histone ubiquitination associates with BRCA1-dependent DNA damage response.
18695986 2009 Analysis of the genes coding for the BRCA1-interacting proteins, RAP80 and Abraxas (CCDC98), in high-risk, non-BRCA1/2, multiethnic breast cancer cases.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18550271 2008 RAP80 and RNF8, key players in the recruitment of repair proteins to DNA damage sites.
18519686 2008 RAP80 responds to DNA damage induced by both ionizing radiation and UV irradiation and is phosphorylated at Ser 205.
18306035 2009 Germline RAP80 mutations and susceptibility to breast cancer.
18270812 2009 Evaluation of the BRCA1 interacting genes RAP80 and CCDC98 in familial breast cancer susceptibility.
18077395 2007 Ubc13/Rnf8 ubiquitin ligases control foci formation of the Rap80/Abraxas/Brca1/Brcc36 complex in response to DNA damage.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17698038 2007 RAP80 interacts with the SUMO-conjugating enzyme UBC9 and is a novel target for sumoylation.
17643122 2007 CCDC98 is a BRCA1-BRCT domain-binding protein involved in the DNA damage response.
17643121 2007 CCDC98 targets BRCA1 to DNA damage sites.
17621610 2007 The ubiquitin-interacting motif containing protein RAP80 interacts with BRCA1 and functions in DNA damage repair response.
17562356 2007 RAP80/UIMC1 as cancer-associated antigen: alternative splice variants and their immunogenicity.
17525342 2007 Ubiquitin-binding protein RAP80 mediates BRCA1-dependent DNA damage response.
17525341 2007 RAP80 targets BRCA1 to specific ubiquitin structures at DNA damage sites.
17525340 2007 Abraxas and RAP80 form a BRCA1 protein complex required for the DNA damage response.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17311814 2007 Ubiquitin-interaction motifs of RAP80 are critical in its regulation of estrogen receptor alpha.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12954732 2004 Tsp57: a novel gene induced during a specific stage of spermatogenesis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12080054 2002 RAP80, a novel nuclear protein that interacts with the retinoid-related testis-associated receptor.