Property Summary

NCBI Gene PubMed Count 25
PubMed Score 36.60
PubTator Score 33.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (3)

Disease log2 FC p
juvenile dermatomyositis 1.153 3.4e-13
primary pancreatic ductal adenocarcinoma 1.016 1.6e-02
ovarian cancer -1.800 1.6e-07

 GWAS Trait (1)

Gene RIF (19)

PMID Text
24813944 A hydrogen bond between the hydroxyl group of 5hmC and UHRF2-SRA is critical for their preferential binding.
24573556 UHRF2 may contribute to the progression of colon carcinogenesis and function as a novel prognostic indicator after curative operation
23833190 UHRF2 is a transcriptional target of E2F, that it directly interacts with E2F1.
23537643 UHRF2, the homolog of UHRF1, interacts with N-methylpurine DNA glycosylase (MPG) in cancer cells.
23404503 UHRF2, a ubiquitin E3 ligase, acts as a small ubiquitin-like modifier E3 ligase for zinc finger protein 131
23244124 Low UHRF2 mRNA expression is associated with malignant glioma.
22673569 NIRF may contribute to the coupling between the cell cycle network and the epigenetic landscape
22072112 In the present study, ubiquitin ligase, NIRF, binds to hepatitis B virus core protein and leads to the proteasome-mediated degradation of hepatitis B virus core protein in vivo.
22018986 NIRF is frequently upregulated in colorectal cancer and its oncogenicity can be suppressed by let-7a microRNA.
21952639 NIRF is immediately adjacent to the single nucleotide polymorphism rs719725, which is reportedly associated with the risk of colorectal cancer.
21598301 the cooperative interplay of Uhrf2 domains may contribute to a tighter epigenetic control of gene expression in differentiated cells
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19818775 Growth-inhibitory effect of let-7a on the A549 cells in vitro and in vivo may be explained in part by le-7a-induced suppression of NIRF and elevation of p21(WAF1).
19218238 UHRF-2 is an essential molecule for nuclear pQ degradation as a component of nuclear PQC machinery in mammalian cells
15178429 may participate in the G1/S transition regulation
15178429 Overexpression of NIRF induces cell cycle arrest at G1 phase. NIRF binds to the cyclin E-Cdk2 complex in vivo, and is phosphorylated by Cdk2 in vitro.
14741369 NIRF has ubiquitination activity, the hallmark of a ubiquitin ligase. PCNP was readily ubiquitinated in 293 and COS-7 cells, and NIRF ubiquitinated PCNP in vitro as well as in vivo.
14741369 NIRF is a ubiquitin ligase that is capable of ubiquitinating PCNP (PEST-containing nuclear protein).
12176013 NIRF is involved in cell-cycle regulation

AA Sequence

MWIQVRTIDGSKTCTIEDVSRKATIEELRERVWALFDVRPECQRLFYRGKQLENGYTLFDYDVGLNDIIQ      1 - 70
LLVRPDPDHLPGTSTQIEAKPCSNSPPKVKKAPRVGPSNQPSTSARARLIDPGFGIYKVNELVDARDVGL     71 - 140
GAWFEAHIHSVTRASDGQSRGKTPLKNGSSCKRTNGNIKHKSKENTNKLDSVPSTSNSDCVAADEDVIYH    141 - 210
IQYDEYPESGTLEMNVKDLRPRARTILKWNELNVGDVVMVNYNVESPGQRGFWFDAEITTLKTISRTKKE    211 - 280
LRVKIFLGGSEGTLNDCKIISVDEIFKIERPGAHPLSFADGKFLRRNDPECDLCGGDPEKKCHSCSCRVC    281 - 350
GGKHEPNMQLLCDECNVAYHIYCLNPPLDKVPEEEYWYCPSCKTDSSEVVKAGERLKMSKKKAKMPSAST    351 - 420
ESRRDWGRGMACVGRTRECTIVPSNHYGPIPGIPVGSTWRFRVQVSEAGVHRPHVGGIHGRSNDGAYSLV    421 - 490
LAGGFADEVDRGDEFTYTGSGGKNLAGNKRIGAPSADQTLTNMNRALALNCDAPLDDKIGAESRNWRAGK    491 - 560
PVRVIRSFKGRKISKYAPEEGNRYDGIYKVVKYWPEISSSHGFLVWRYLLRRDDVEPAPWTSEGIERSRR    561 - 630
LCLRLQYPAGYPSDKEGKKPKGQSKKQPSGTTKRPISDDDCPSASKVYKASDSAEAIEAFQLTPQQQHLI    631 - 700
REDCQNQKLWDEVLSHLVEGPNFLKKLEQSFMCVCCQELVYQPVTTECFHNVCKDCLQRSFKAQVFSCPA    701 - 770
CRHDLGQNYIMIPNEILQTLLDLFFPGYSKGR                                          771 - 802
//

Text Mined References (30)

PMID Year Title
24813944 2014 Structural basis for hydroxymethylcytosine recognition by the SRA domain of UHRF2.
24573556 2014 Ubiquitin-like with PHD and ring finger domains 2 is a predictor of survival and a potential therapeutic target in colon cancer.
23833190 2013 The nuclear protein UHRF2 is a direct target of the transcription factor E2F1 in the induction of apoptosis.
23537643 2013 Identification of UHRF1/2 as new N-methylpurine DNA glycosylase-interacting proteins.
23404503 2013 UHRF2, a ubiquitin E3 ligase, acts as a small ubiquitin-like modifier E3 ligase for zinc finger protein 131.
23244124 2012 UHRF2 mRNA expression is low in malignant glioma but silencing inhibits the growth of U251 glioma cells in vitro.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22699663 2012 Genome-wide association study of periodontal pathogen colonization.
22673569 2012 NIRF/UHRF2 occupies a central position in the cell cycle network and allows coupling with the epigenetic landscape.
22072112 2012 NIRF, a novel ubiquitin ligase, interacts with hepatitis B virus core protein and promotes its degradation.
22018986 2012 NIRF is frequently upregulated in colorectal cancer and its oncogenicity can be suppressed by let-7a microRNA.
21952639 2011 NIRF constitutes a nodal point in the cell cycle network and is a candidate tumor suppressor.
21598301 2011 Cooperative DNA and histone binding by Uhrf2 links the two major repressive epigenetic pathways.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19818775 2009 Let-7a elevates p21(WAF1) levels by targeting of NIRF and suppresses the growth of A549 lung cancer cells.
19218238 2009 Intranuclear degradation of polyglutamine aggregates by the ubiquitin-proteasome system.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15361834 2004 ICBP90, an E2F-1 target, recruits HDAC1 and binds to methyl-CpG through its SRA domain.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15178429 2004 NIRF induces G1 arrest and associates with Cdk2.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14741369 2004 NIRF is a ubiquitin ligase that is capable of ubiquitinating PCNP, a PEST-containing nuclear protein.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12176013 2002 NIRF, a novel RING finger protein, is involved in cell-cycle regulation.