Property Summary

NCBI Gene PubMed Count 116
PubMed Score 0.00
PubTator Score 132.91

Knowledge Summary

Patent

No data available

 Compartment GO Term (1)

Protein-protein Interaction (1)

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
687016 screening 2779 / 0 / 367497 Counterscreen for inhibitors of 5-meCpG-binding domain protein 2 (MBD2): TRFRET-based biochemical primary high throughput screening assay to identify inhibitors of binding of ubiquitin-like with PHD and ring finger domains 1 (UHRF1) to methylated oligonucleotide
720530 screening 256 / 0 / 780 Counterscreen for inhibitors of 5-meCpG-binding domain protein 2 (MBD2): TRFRET-based biochemical high throughput screening assay to identify inhibitors of binding of ubiquitin-like with PHD and ring finger domains 1 (UHRF1) to methylated oligonucleotide
720644 confirmatory 4 / 0 / 42 Counterscreen for inhibitors of 5-meCpG-binding domain protein 2 (MBD2): TRFRET-based biochemical high throughput dose response assay to identify inhibitors of binding of ubiquitin-like with PHD and ring finger domains 1 (UHRF1) to methylated oligonucleotide

Gene RIF (98)

PMID Text
27045799 Hemi-methylated DNA opens a closed conformation of UHRF1 to facilitate its H3 histone recognition.
26884069 Results showed that UHRF1 was overexpressed in almost all of the prostate cancer cell (PCa) lines. Its expression levels were correlated with some clinical features of PCa suggesting it as an independent prognostic factor for biochemical recurrence.
26768845 results suggest that UPAT and UHRF1 may be promising molecular targets for the therapy of colon cancer
26752645 These findings identify ICBP90 as a key regulator of MIF transcription and provide functional insight into the regulation of the polymorphic MIF locus.
26727879 This study showed that UHRF1 interacts directly with BRCA1 and is involved in DNA double-strand break repair.
26700964 Studies indicate that ubiquitin like with PHD and ring finger domains 1 protein (UHRF1) interacts with DNA interstrand crosslinks (ICLs) both in vitro and in vivo.
26597461 UHRF1 could form a complex with PRMT5 to contribute to the endometrial carcinogenesis.
26548607 UHRF1 promotes osteosarcoma cell invasion by downregulating the expression of Ecadherin and increasing epithelialtomesenchymal transition in an Rb1dependent manner.
26497117 K-Ras drives UHRF1 expression, establishing a novel link between this oncogene and Nrf2-mediated cellular protection.
26464697 UHRF1 was over-expressed in hepatocellular carcinoma tissues compared to the adjacent normal tissues and UHRF1 expression shared significant relevance with distant metastasis, cancer area and HBV.
26368281 results are consistent with a "reader" role, in which the SRA domain scans DNA sequences for hemimethylated CpG sites without perturbation of the structure of contacted nucleotides.
26310391 miR-124 could control the fate of target gene UHRF1 mRNA by binding 3'-UTR
26239364 The downregulation of UHRF1 by Torin-1 was partially due to a decrease in the UHRF1 mRNA level. Torin-2 effectively inhibited hepatocellular carcinoma cell proliferation through induction of autophagy
26161699 UHRF1 is overexpressed in serum and gastric tissue of stomach cancer patients.
26147747 UHRF1 promotes proliferation of gastric cancer via mediating tumor suppressor gene hypermethylation.
26102039 UHRF1 regulates p53 ubiquitination and p53-dependent cell apoptosis in clear cell renal cell carcinoma.
26070868 UHRF1 could act as a new oncogenic factor in ovarian cancer and be a potential molecular target for ovarian cancer gene therapy.
26049093 Promoter hypermethylation and down-expression of let-7a-3 may play a role in DN by targeting UHRF1.
25982273 LASP-1 associated with UHRF1, G9a, Snail1 and di- and tri-methylated histoneH3 in a CXCL12-dependent manner based on immunoprecipitation and proximity ligation assays
25940709 miR-9 could repress the expression of UHRF1, and function as a tumor-suppressive microRNA in colorectal cancer.
25818288 UHRF1 promotes recruitment of lesion-processing activities via its affinity to recognize DNA damage
25801034 describe a mechanism of interstrand crosslink (ICL) sensing and propose that UHRF1 is a critical factor that binds to ICLs. In turn, this binding is necessary for the subsequent recruitment of FANCD2, which allows the DNA repair process to initiate
25743796 High UHRF1 expression is associated with ovarian cancer.
25641194 Findings demonstrated the inhibitory effect of MEG3 in vivo and vitro and illuminated that MEG3 could be a potential biomarker for the survival of hepatocellular carcinoma (HCC) patients. Its expression seemed to be regulated by UHRF1 in HCC.
25572953 UHRF1 may play a pivotal role in suppressing the malignant alteration of cancer cells.
25550546 CD47 regulates the epigenetic code by targeting UHRF1.
25451918 UHRF1 interacts with TopoIIalpha and regulates its localization to hemimethylated DNA. TopoIIalpha decatenates the hemimethylated DNA following replication, which might facilitate the methylation of the nascent strand by DNMT1
25430639 Results show that UHRF1 is overexpressed in subgroups of patients with liver cancer and its repression through T3/TR signaling induces hepatoma cell growth inhibition.
25416862 our study demonstrated that UHRF1 played an oncogenic role in the progression of pancreatic cancer, and UHRF1 might be a promising target for the treatment of pancreatic cancer.
25338120 Upregulation of HELLS and UHRF1 is essential for the tumor phenotype. Also, these epigenetic regulators are important for the regulation of SYK.
25323766 Epigenetic repression of RGS2 by UHRF1 contributes to bladder cancer progression. UHRF1 inhibits RGS2 expression by increasing the methylation of CpG nucleotides of the RGS2 promoter.
25272010 These data demonstrated that upregulated UHRF1 increases bladder cancer cell invasion by epigenetic silencing of KiSS1.
25207720 Luteolin induces UHRF1 and DNMT1 downregulation and stimulates p16INK4A reexpression in human colon cancer cell line BE.
25189999 By DNA methyltransferase 1 under regulation by Uhrf1.
24813945 Binding of the phosphatidylinositol phosphate to the polybasic region of UHRF1 results in a conformational rearrangement of the domains, allowing the tandem tudor domain to bind H3K9me3.
24756644 Our findings suggest that UHRF1 is involved in the proliferation and migration of GBC cells and may serve as a biomarker or even a therapeutic target for GBC.
24706678 Results implicate UHRF1 as an oncogene and suggest that global DNA hypomethylation induced by UHRF1 overexpression induces a p53-mediated senescence program that is bypassed in hepatocellular carcinoma.
24637615 The global DNA hypomethylation induced by the DNMT1/PCNA/UHRF1 disruption is an oncogenic event of human tumorigenesis.
24486181 UHRF1 overexpression drives DNA hypomethylation leading to hepatocellular carcinoma.
24134914 reviews the principles how UHRF1 acts as an epigenetic reader and discusses the properties of UHRF1 to be a biomarker as well as a therapeutic target
24005809 Increased expression of UHRF1 was an independent prognostic factor for LSCC.
23943380 Inhibiting UHRF1 expression enhances radiosensitivity in human esophageal squamous cell carcinoma.
23752590 linked tandem Tudor & PHD of UHRF1 operates as a functional unit in cells, providing a defined combinatorial readout of a heterochromatin signature within a single histone H3 tail, essential for UHRF1-directed epigenetic inheritance of DNA methylation
23677994 UHRF1 is a critical negative regulator of TIP60 and suggest that UHRF1-mediated effects on p53 may contribute, at least in part, to its role in tumorigenesis.
23537643 UHRF1 interacts with N-methylpurine DNA glycosylase (MPG) in cancer cells in vitro and displays a co-localization with MPG in the nucleoplasm.
23463006 UHRF1 can target DNMT1 for DNA maintenance methylation through binding either histone 3 lysine 9 methylation 2/3 or hemi-methylated CpG.
23297342 UHRF1 degradation is accelerated in response to DNA damage.
23245651 From alchemical mutation free energy calculations the study finds that the binding affinity of fully-methylated DNA to UHRF1 is weaker by 17.9kJ/mol relative to the binding of hemi-methylated DNA.
23161542 H3K9me3 peptide induces conformational changes of TTD-PHD, which do not affect the autoubiquitination activity or hemimethylated DNA binding affinity of UHRF1 in vitro
23107467 High UHRF1 DNA level in plasma was significantly associated with short progression-free survival.
23023523 UHRF1 may be involved in cellular proliferation and molecular pathogenesis of colorectal cancer in the right hemicolon.
23022729 UHRF1 association with methylated histone H3 Lys9 (H3K9) is required for DNA methylation maintenance.
22945642 These findings suggest that UHRF1 promotes the turnover of PML protein
22837395 UHRF1 contains linked two-histone reader modules tethered by a 17-aa linker, which plays a role as a functional switch involved in multiple regulatory pathways such as maintenance of DNA methylation and transcriptional repression.
22552622 UHRF1 promoted the proliferation of breast cancer cells by apoptosis inhibition, G1 phase shortage and promotion of tumor vessel formation
22411829 A cell cycle-specific signaling event that relieves UHRF1 from its interaction with USP7, is reported.
22330138 Depletion of UHRF1 resulted in reactivation of several tumour suppressor genes.
22286757 UHRF1 coordinates peroxisome proliferator activated receptor gamma epigenetic silencing and mediates colorectal cancer progression.
22285022 The fusion of NRIP1 with UHRF1 involved in the unbalanced translocation between chromosomes 19 and 21 in a patient with an ALL-positive for a t(9;22) translocation.
22219067 High UHRF1 expression is associated with colorectal cancer.
22100450 UHRF1 PHD finger (including the preceding zinc-Cys4 knuckle) acts together with the adjacent double Tudor domain to specifically recognize the H3K9me3 mark.
22096602 The PHD finger of human UHRF1 reveals a new subgroup of unmethylated histone H3 tail readers.
21808300 the PHD domain of UHRF1 is an epigenetic regulatory module dedicated to the recognition of an unmodified arginine residue (R2) on histone H3
21777816 PHD finger recognition of unmodified histone H3R2 links UHRF1 to regulation of euchromatic gene expression
21611839 High UHRF1 is associated with tumor recurrence in non-muscle-invasive bladder cancer.
21539450 the downregulation of UHRF1 in both breast cancer cell lines significantly inhibited the colony formation capacity.
21489993 Recognition of multivalent histone states associated with heterochromatin by UHRF1 protein.
21351083 UHRF1 should be considered, along with DNMTs, among the potential targets for cancer treatment and/or therapeutic stratification.
21296067 down-regulation of ICBP90 induced the descended expression of Topo IIalpha protein which is the target enzyme of doxorubicin
21268065 Findings suggest that, by balancing Dnmt1 ubiquitination, Usp7 and Uhrf1 fine tune Dnmt1 stability.
21214517 Data suggest that UHRF1 links epigenetic regulation with DNA replication. UHRF1 depletion/knockdown leads to caspase 8-mediated apoptosis, cell cycle arrest, and cell death. UHRF1 accumulates rapidly at sites of DNA injury.
21067293 UHRF1 confers radioresistance to human breast cancer cells
20613874 results reveal that the disruption of Dnmt1/PCNA/UHRF1 interactions acts as an oncogenic event and that one of its signatures (i.e. the low level of mMTase activity) is a molecular biomarker associated with a poor prognosis in GBM patients
20198315 Observational study of gene-disease association. (HuGE Navigator)
20037778 Knockdown of UHRF1 activates MDR1 promoter activity and expression, attenuates the binding of UHRF1 and HDAC1 to the MDR1 promoter.Overexpression of UHRF1 in NCI/ADR-RES cells can induce deacetylation of histones H3 and H4 on the MDR1 promoter
19943104 UHRF1 regulates BRCA1 transcription by inducing DNA methylation, histone modifications, and recruitment of transcriptional complex on the BRCA1 promoter in breast neoplasms.
19851296 Observational study of gene-disease association. (HuGE Navigator)
19800870 Tip60 is a novel partner of the epigenetic integration platform interplayed by UHRF1, DNMT1 and HDAC1 involved in the epigenetic code replication.
19798101 Np95, Dnmt3a and Dnmt3b have regulatory roles in mediating epigenetic silencing through histone modification followed by DNA methylation
19491893 Significant overexpression of UHRF1 was observed in bladder cancer. The overexpression was correlated with the stage and grade of the cancer.
19328461 ICBP90 might be a pivotal target for the ERK1/2 signaling pathway to control the proliferation of Jurkat T cells.
19270723 role of UHRF1 in human cervical cancer cells as a negative regulator of radiosensitivity.
19077538 UHRF1 may bring two components (histones and DNA) carrying appropriate markers (on the tails of H3 and hemimethylated CpG sites) ready to be assembled into a nucleosome after replication
19056828 UHRF1 recruited and cooperated with G9a to inhibit the p21 promoter activity, which correlated with the elevated p21 protein level in human UHRF1 siRNA-transfected HeLa cells.
18945682 structural analysis and hemimethylated CpG binding of the SRA domain from human UHRF1
18772889 the 1.7 A crystal structure of the apo SRA domain of human UHRF1 and a 2.2 A structure of its complex with hemi-methylated DNA, revealing a previously unknown reading mechanism for methylated CpG sites (mCpG)
18005238 Parasite proliferation was suppressed in G1-arrested cells induced by UHRF1-siRNA, indicating the importance of the G2 phase via UHRF1-induced G1/S transition for T. gondii growth.
17967883 ICBP90 is required for proper heterochromatin formation in mammalian cells
17934516 A new role of ICBP90 in the relationship between histone ubiquitination and DNA methylation in the context of tumoral angiogenesis and tumour suppressor genes silencing.
17673620 data suggest that UHRF1 may help recruit DNMT1 to hemimethylated DNA to facilitate faithful maintenance of DNA methylation
17067204 These findings collectively indicate that the human NP95 gene is the functional orthologue of the murine Np95 gene.
17065439 UHRF1 inhibits the late phase of oligodendrocyte differentiation.
16195352 General requirement for UHRF1 in tumor cell proliferation implicates the RING domain of UHRF1 as a functional determinant of growth regulation.
16007129 ICBP90 overexpression is involved in the altered checkpoint controls occurring in cancerogenesis
15964557 ICBP90 down-regulation is a key event in G1 arrest preceding T cell death
15361834 ICBP90 is involved in cell proliferation by way of methylation-mediated regulation of certain genes.
15033738 Apoptosis is dependent upon ICBP90 expression downregulation and ICBP90 exhibits anti-apoptotic properties.
12838312 ICBP90 expression altered in cancer cell lines and upregulated by E2F-1 overexpression, with efficiency depending on cancer status of cell line

AA Sequence

MWIQVRTMDGRQTHTVDSLSRLTKVEELRRKIQELFHVEPGLQRLFYRGKQMEDGHTLFDYEVRLNDTIQ      1 - 70
LLVRQSLVLPHSTKERDSELSDTDSGCCLGQSESDKSSTHGEAAAETDSRPADEDMWDETELGLYKVNEY     71 - 140
VDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVIYHVKYDDYPENGVVQMNSRDVRARART    141 - 210
IIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKI    211 - 280
ERPGEGSPMVDNPMRRKSGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLS    281 - 350
SVPSEDEWYCPECRNDASEVVLAGERLRESKKKAKMASATSSSQRDWGKGMACVGRTKECTIVPSNHYGP    351 - 420
IPGIPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDHGNFFTYTGSGGRDLSGNK    421 - 490
RTAEQSCDQKLTNTNRALALNCFAPINDQEGAEAKDWRSGKPVRVVRNVKGGKNSKYAPAEGNRYDGIYK    491 - 560
VVKYWPEKGKSGFLVWRYLLRRDDDEPGPWTKEGKDRIKKLGLTMQYPEGYLEALANREREKENSKREEE    561 - 630
EQQEGGFASPRTGKGKWKRKSAGGGPSRAGSPRRTSKKTKVEPYSLTAQQSSLIREDKSNAKLWNEVLAS    631 - 700
LKDRPASGSPFQLFLSKVEETFQCICCQELVFRPITTVCQHNVCKDCLDRSFRAQVFSCPACRYDLGRSY    701 - 770
AMQVNQPLQTVLNQLFPGYGNGR                                                   771 - 793
//

Text Mined References (131)

PMID Year Title
27045799 2016 Hemi-methylated DNA opens a closed conformation of UHRF1 to facilitate its histone recognition.
26884069 2016 UHRF1 overexpression is involved in cell proliferation and biochemical recurrence in prostate cancer after radical prostatectomy.
26768845 2016 Long noncoding RNA UPAT promotes colon tumorigenesis by inhibiting degradation of UHRF1.
26752645 2016 Transcription factor ICBP90 regulates the MIF promoter and immune susceptibility locus.
26727879 2016 A cell cycle-dependent BRCA1-UHRF1 cascade regulates DNA double-strand break repair pathway choice.
26700964 2016 UHRF1 is a sensor for DNA interstrand crosslinks.
26597461 2016 Methylation of tumor suppressor gene CDH13 and SHP1 promoters and their epigenetic regulation by the UHRF1/PRMT5 complex in endometrial carcinoma.
26548607 2016 UHRF1 promotes human osteosarcoma cell invasion by downregulating the expression of E?cadherin in an Rb1?dependent manner.
26497117 2016 UHRF1 regulation of the Keap1-Nrf2 pathway in pancreatic cancer contributes to oncogenesis.
26464697 2015 Elevated expression of UHRF1 predicts unfavorable prognosis for patients with hepatocellular carcinoma.
26368281 2015 Site-Selective Monitoring of the Interaction of the SRA Domain of UHRF1 with Target DNA Sequences Labeled with 2-Aminopurine.
26310391 2015 MiR-124 exerts tumor suppressive functions on the cell proliferation, motility and angiogenesis of bladder cancer by fine-tuning UHRF1.
26239364 2015 The novel mTOR inhibitor Torin-2 induces autophagy and downregulates the expression of UHRF1 to suppress hepatocarcinoma cell growth.
26161699 2015 Analysis of the UHRF1 expression in serum and tissue for gastric cancer detection.
26147747 2015 UHRF1 promotes proliferation of gastric cancer via mediating tumor suppressor gene hypermethylation.
26102039 2015 Ubiquitin E3 ligase UHRF1 regulates p53 ubiquitination and p53-dependent cell apoptosis in clear cell Renal Cell Carcinoma.
26070868 2015 Analysis of UHRF1 expression in human ovarian cancer tissues and its regulation in cancer cell growth.
26049093 2015 Promoter hypermethylation of let-7a-3 is relevant to its down-expression in diabetic nephropathy by targeting UHRF1.
25982273 2016 LASP-1: a nuclear hub for the UHRF1-DNMT1-G9a-Snail1 complex.
25940709 2015 Regulation of UHRF1 by microRNA-9 modulates colorectal cancer cell proliferation and apoptosis.
25818288 2015 UHRF1 contributes to DNA damage repair as a lesion recognition factor and nuclease scaffold.
25801034 2015 UHRF1 is a sensor for DNA interstrand crosslinks and recruits FANCD2 to initiate the Fanconi anemia pathway.
25743796 2015 Knockdown of UHRF1 by lentivirus-mediated shRNA inhibits ovarian cancer cell growth.
25641194 2016 The aberrant expression of MEG3 regulated by UHRF1 predicts the prognosis of hepatocellular carcinoma.
25572953 2015 Downregulation of UHRF1 promotes EMT via inducing CXCR4 in human cancer cells.
25550546 2015 CD47 activation-induced UHRF1 over-expression is associated with silencing of tumor suppressor gene p16INK4A in glioblastoma cells.
25451918 2015 Topoisomerase II regulates the maintenance of DNA methylation.
25430639 2015 Negative modulation of the epigenetic regulator, UHRF1, by thyroid hormone receptors suppresses liver cancer cell growth.
25416862 2015 Up-regulation of UHRF1 by oncogenic Ras promoted the growth, migration, and metastasis of pancreatic cancer cells.
25338120 2014 Chromatin remodelers HELLS and UHRF1 mediate the epigenetic deregulation of genes that drive retinoblastoma tumor progression.
25323766 2015 Epigenetic repression of regulator of G-protein signaling 2 by ubiquitin-like with PHD and ring-finger domain 1 promotes bladder cancer progression.
25272010 2014 Upregulated UHRF1 promotes bladder cancer cell invasion by epigenetic silencing of KiSS1.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25207720 2014 Luteolin induces apoptosis in BE colorectal cancer cells by downregulating calpain, UHRF1, and DNMT1 expressions.
25189999 2014 Reversible epigenetic regulation of 14-3-3? expression in acquired gemcitabine resistance by uhrf1 and DNA methyltransferase 1.
24813945 2014 Accessibility of different histone H3-binding domains of UHRF1 is allosterically regulated by phosphatidylinositol 5-phosphate.
24756644 2014 UHRF1 depletion suppresses growth of gallbladder cancer cells through induction of apoptosis and cell cycle arrest.
24706678 2014 UHRF1 is an oncogene that promotes DNA hypomethylation.
24637615 2014 The DNMT1/PCNA/UHRF1 disruption induces tumorigenesis characterized by similar genetic and epigenetic signatures.
24486181 2014 UHRF1 overexpression drives DNA hypomethylation and hepatocellular carcinoma.
24469333 Dual base-flipping of cytosines in a CpG dinucleotide sequence.
24324066 2013 Green tea polyphenol epigallocatechin 3-gallate, contributes to the degradation of DNMT3A and HDAC3 in HCT 116 human colon cancer cells.
24134914 2013 Increasing role of UHRF1 in the reading and inheritance of the epigenetic code as well as in tumorogenesis.
24035451 2013 Tudor: a versatile family of histone methylation 'readers'.
24005809 2013 Overexpression of UHRF1 is significantly associated with poor prognosis in laryngeal squamous cell carcinoma.
23943380 2013 Inhibiting UHRF1 expression enhances radiosensitivity in human esophageal squamous cell carcinoma.
23752590 2013 Multivalent histone engagement by the linked tandem Tudor and PHD domains of UHRF1 is required for the epigenetic inheritance of DNA methylation.
23677994 2013 Negative regulation of the acetyltransferase TIP60-p53 interplay by UHRF1 (ubiquitin-like with PHD and RING finger domains 1).
23537643 2013 Identification of UHRF1/2 as new N-methylpurine DNA glycosylase-interacting proteins.
23463006 2013 UHRF1 targets DNMT1 for DNA methylation through cooperative binding of hemi-methylated DNA and methylated H3K9.
23297342 2013 DNA damage regulates UHRF1 stability via the SCF(?-TrCP) E3 ligase.
23245651 2013 UHRF1 discriminates against binding to fully-methylated CpG-Sites by steric repulsion.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23161542 2013 Structural insight into coordinated recognition of trimethylated histone H3 lysine 9 (H3K9me3) by the plant homeodomain (PHD) and tandem tudor domain (TTD) of UHRF1 (ubiquitin-like, containing PHD and RING finger domains, 1) protein.
23107467 2013 Diagnostic and prognostic value of plasma and tissue ubiquitin-like, containing PHD and RING finger domains 1 in breast cancer patients.
23023523 2012 UHRF1 expression is upregulated and associated with cellular proliferation in colorectal cancer.
23022729 2012 Association of UHRF1 with methylated H3K9 directs the maintenance of DNA methylation.
22945642 2013 The epigenetic regulator UHRF1 promotes ubiquitination-mediated degradation of the tumor-suppressor protein promyelocytic leukemia protein.
22837395 2012 Recognition of modification status on a histone H3 tail by linked histone reader modules of the epigenetic regulator UHRF1.
22552622 2012 Exogenous expression of UHRF1 promotes proliferation and metastasis of breast cancer cells.
22411829 2012 M phase phosphorylation of the epigenetic regulator UHRF1 regulates its physical association with the deubiquitylase USP7 and stability.
22330138 2012 The SRA protein UHRF1 promotes epigenetic crosstalks and is involved in prostate cancer progression.
22286757 2012 UHRF1 coordinates peroxisome proliferator activated receptor gamma (PPARG) epigenetic silencing and mediates colorectal cancer progression.
22285022 2011 A possible 5'-NRIP1/UHRF1-3' fusion gene detected by array CGH analysis in a Ph+ ALL patient.
22219067 2012 UHRF1 promotes cell growth and metastasis through repression of p16(ink?a) in colorectal cancer.
22100450 2012 UHRF1 double tudor domain and the adjacent PHD finger act together to recognize K9me3-containing histone H3 tail.
22096602 2011 The PHD finger of human UHRF1 reveals a new subgroup of unmethylated histone H3 tail readers.
21808300 2011 Crystal structure of PHD domain of UHRF1 and insights into recognition of unmodified histone H3 arginine residue 2.
21808299 2011 Structural basis for site-specific reading of unmodified R2 of histone H3 tail by UHRF1 PHD finger.
21777816 2011 PHD finger recognition of unmodified histone H3R2 links UHRF1 to regulation of euchromatic gene expression.
21745816 2011 The USP7/Dnmt1 complex stimulates the DNA methylation activity of Dnmt1 and regulates the stability of UHRF1.
21731699 2011 Recognition of 5-hydroxymethylcytosine by the Uhrf1 SRA domain.
21611839 2012 UHRF1 is associated with tumor recurrence in non-muscle-invasive bladder cancer.
21539450 2011 Inhibition effect of siRNA-downregulated UHRF1 on breast cancer growth.
21489993 2011 Recognition of multivalent histone states associated with heterochromatin by UHRF1 protein.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21351083 2011 UHRF1-mediated tumor suppressor gene inactivation in nonsmall cell lung cancer.
21296067 2011 Down-regulation of ICBP90 contributes to doxorubicin resistance.
21269460 2011 Initial characterization of the human central proteome.
21268065 2011 Usp7 and Uhrf1 control ubiquitination and stability of the maintenance DNA methyltransferase Dnmt1.
21214517 2011 UHRF1 depletion causes a G2/M arrest, activation of DNA damage response and apoptosis.
21067293 2011 UHRF1 confers radioresistance to human breast cancer cells.
21029866 2010 Nucleosome-interacting proteins regulated by DNA and histone methylation.
20613874 2010 Disruption of Dnmt1/PCNA/UHRF1 interactions promotes tumorigenesis from human and mice glial cells.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20037778 2010 UHRF1 inhibits MDR1 gene transcription and sensitizes breast cancer cells to anticancer drugs.
20026581 2010 The multi-domain protein Np95 connects DNA methylation and histone modification.
19943104 2010 UHRF1 is associated with epigenetic silencing of BRCA1 in sporadic breast cancer.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19800870 2009 UHRF1 recruits the histone acetyltransferase Tip60 and controls its expression and activity.
19798101 2009 Np95 interacts with de novo DNA methyltransferases, Dnmt3a and Dnmt3b, and mediates epigenetic silencing of the viral CMV promoter in embryonic stem cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19491893 2009 UHRF1 is a novel molecular marker for diagnosis and the prognosis of bladder cancer.
19328461 2009 ICBP90 mediates the ERK1/2 signaling to regulate the proliferation of Jurkat T cells.
19270723 2009 Adenovirus-mediated expression of UHRF1 reduces the radiosensitivity of cervical cancer HeLa cells to gamma-irradiation.
19077538 2009 UHRF1, a modular multi-domain protein, regulates replication-coupled crosstalk between DNA methylation and histone modifications.
19056828 2009 UHRF1 binds G9a and participates in p21 transcriptional regulation in mammalian cells.
18945682 2008 Structure and hemimethylated CpG binding of the SRA domain from human UHRF1.
18931436 2008 Expression, purification, crystallization and preliminary crystallographic study of the SRA domain of the human UHRF1 protein.
18772889 2008 Structural basis for recognition of hemi-methylated DNA by the SRA domain of human UHRF1.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18005238 2008 Toxoplasma gondii exploits UHRF1 and induces host cell cycle arrest at G2 to enable its proliferation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17967883 2008 ICBP90, a novel methyl K9 H3 binding protein linking protein ubiquitination with heterochromatin formation.
17934516 2008 The interaction of the SRA domain of ICBP90 with a novel domain of DNMT1 is involved in the regulation of VEGF gene expression.
17673620 2007 UHRF1 plays a role in maintaining DNA methylation in mammalian cells.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17067204 2006 Isolation and Characterization of a Novel Human Radiosusceptibility Gene, NP95.
17065439 2006 Functional genomic analysis of oligodendrocyte differentiation.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16195352 2005 Critical role of the ubiquitin ligase activity of UHRF1, a nuclear RING finger protein, in tumor cell growth.
16007129 2005 The retinoblastoma gene and its product are targeted by ICBP90: a key mechanism in the G1/S transition during the cell cycle.
15964557 2005 TCR pathway involves ICBP90 gene down-regulation via E2F binding sites.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15361834 2004 ICBP90, an E2F-1 target, recruits HDAC1 and binds to methyl-CpG through its SRA domain.
15178447 2004 Phosphorylation of ICBP90 by protein kinase A enhances topoisomerase IIalpha expression.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15057824 2004 The DNA sequence and biology of human chromosome 19.
15033738 2003 ICBP90 expression is downregulated in apoptosis-induced Jurkat cells.
15009091 2004 Down-regulation of nuclear protein ICBP90 by p53/p21Cip1/WAF1-dependent DNA-damage checkpoint signals contributes to cell cycle arrest at G1/S transition.
14993289 2004 Np95 is a histone-binding protein endowed with ubiquitin ligase activity.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12838312 2003 ICBP90 belongs to a new family of proteins with an expression that is deregulated in cancer cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11290415 2001 Genomic structure and chromosomal mapping of the gene coding for ICBP90, a protein involved in the regulation of the topoisomerase IIalpha gene expression.
10646863 2000 ICBP90, a novel human CCAAT binding protein, involved in the regulation of topoisomerase IIalpha expression.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.